Actinosynnema_pretiosum_subsp_pretiosum - 40 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

BAAATP010000001.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like,T1PKS,hglE-KS	160,632	219,859
Region 1.2	ectoine	295,885	306,259
Region 1.3	betalactone	435,173	463,032
Region 1.4	T1PKS	488,097	595,818	High	salinilactam	PKS
Region 1.5	NRP-metallophore,NRPS	596,751	657,455	High	mirubactin	NRPS:Type I
Region 1.6	nucleoside	734,196	755,185	Medium	tunicamycin B1	other:nucleoside

BAAATP010000005.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	RiPP-like	385,160	396,008

BAAATP010000006.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	NRPS,azoxy-crosslink,nucleoside	158,956	310,830	High	detoxin P1/detoxin P2/detoxin P3	NRPS:Type I+PKS

BAAATP010000007.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	terpene	70,084	92,333	High	geosmin	terpene:Sesquiterpene

BAAATP010000009.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	T1PKS,terpene	1	57,762
Region 9.2	T1PKS	65,459	131,700

BAAATP010000010.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	terpene-precursor	131,756	152,826	Low	isorenieratene	terpene
Region 10.2	lanthipeptide-class-iii	217,452	240,016	Low	Ery-9/Ery-6/Ery-8/Ery-7/Ery-5/Ery-4/Ery-3	ribosomal:RiPP:Lanthipeptide

BAAATP010000011.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	indole	43,041	64,117

BAAATP010000012.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	PKS-like,2dos,NRPS	2,607	67,839	Low	rubiginone A2/rubiginone J/rubiginone K/rubiginone L/rubiginone M/rubiginone N/ochromycinone/rubiginone B2	PKS
Region 12.2	T1PKS	116,334	173,868
Region 12.3	T1PKS	214,764	260,523

BAAATP010000013.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	NRPS	1	26,267
Region 13.2	thioamitides	254,167	276,588

BAAATP010000015.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NRPS,T1PKS	59,500	107,166
Region 15.2	NRP-metallophore,NRPS	135,035	190,847	Low	peucechelin	NRPS:Type I
Region 15.3	terpene-precursor	207,717	228,757

BAAATP010000016.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	crocagin,betalactone,T1PKS,NRPS	30,350	161,590	High	tomaymycin	NRPS:Type I
Region 16.2	CDPS	203,960	224,661

BAAATP010000017.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	lassopeptide	17,010	39,907	Medium	citrulassin F	ribosomal:RiPP
Region 17.2	T1PKS	131,853	215,739	High	tripartilactam/niizalactam C	PKS

BAAATP010000019.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	terpene	54,099	90,838	High	isorenieratene	terpene
Region 19.2	azole-containing-RiPP	114,844	141,907

BAAATP010000023.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	lanthipeptide-class-ii	12,251	35,388

BAAATP010000024.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	NRPS	64,249	108,631	Low	SF2768	NRPS:Type I

BAAATP010000028.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	T1PKS	1	53,344	High	macbecin/macbecin II	PKS
Region 28.2	T1PKS	92,169	116,556	Low	maytansine/ansamitocin P-3	PKS

BAAATP010000029.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	terpene	1	12,819

BAAATP010000031.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	opine-like-metallophore	1	18,268	Low	bacillopaline	other:other

BAAATP010000032.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	hydrogen-cyanide	1	9,483
Region 32.2	bottromycin	21,356	42,174	High	bottromycin A2	ribosomal:RiPP:Bottromycin

BAAATP010000035.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 35.1	NRPS-like,T1PKS,NRPS	1	77,135	Low	ansamitocin P-3	PKS

BAAATP010000036.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	lassopeptide	6,080	28,543	Low	felipeptin A2/felipeptin A1	ribosomal:RiPP

BAAATP010000041.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 41.1	T1PKS,NRPS	1	47,579	Low	amipurimycin	PKS

BAAATP010000057.1 (Actinosynnema pretiosum subsp. pretiosum)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 57.1	lassopeptide	1	9,529

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS-like,T1PKS,hglE-KS	160,632	219,859
Region 1.2	ectoine	295,885	306,259
Region 1.3	betalactone	435,173	463,032
Region 1.4	T1PKS	488,097	595,818	High	salinilactam	PKS
Region 1.5	NRP-metallophore,NRPS	596,751	657,455	High	mirubactin	NRPS:Type I
Region 1.6	nucleoside	734,196	755,185	Medium	tunicamycin B1	other:nucleoside
Region 5.1	RiPP-like	385,160	396,008
Region 6.1	NRPS,azoxy-crosslink,nucleoside	158,956	310,830	High	detoxin P1/detoxin P2/detoxin P3	NRPS:Type I+PKS
Region 7.1	terpene	70,084	92,333	High	geosmin	terpene:Sesquiterpene
Region 9.1	T1PKS,terpene	1	57,762
Region 9.2	T1PKS	65,459	131,700
Region 10.1	terpene-precursor	131,756	152,826	Low	isorenieratene	terpene
Region 10.2	lanthipeptide-class-iii	217,452	240,016	Low	Ery-9/Ery-6/Ery-8/Ery-7/Ery-5/Ery-4/Ery-3	ribosomal:RiPP:Lanthipeptide
Region 11.1	indole	43,041	64,117
Region 12.1	PKS-like,2dos,NRPS	2,607	67,839	Low	rubiginone A2/rubiginone J/rubiginone K/rubiginone L/rubiginone M/rubiginone N/ochromycinone/rubiginone B2	PKS
Region 12.2	T1PKS	116,334	173,868
Region 12.3	T1PKS	214,764	260,523
Region 13.1	NRPS	1	26,267
Region 13.2	thioamitides	254,167	276,588
Region 15.1	NRPS,T1PKS	59,500	107,166
Region 15.2	NRP-metallophore,NRPS	135,035	190,847	Low	peucechelin	NRPS:Type I
Region 15.3	terpene-precursor	207,717	228,757
Region 16.1	crocagin,betalactone,T1PKS,NRPS	30,350	161,590	High	tomaymycin	NRPS:Type I
Region 16.2	CDPS	203,960	224,661
Region 17.1	lassopeptide	17,010	39,907	Medium	citrulassin F	ribosomal:RiPP
Region 17.2	T1PKS	131,853	215,739	High	tripartilactam/niizalactam C	PKS
Region 19.1	terpene	54,099	90,838	High	isorenieratene	terpene
Region 19.2	azole-containing-RiPP	114,844	141,907
Region 23.1	lanthipeptide-class-ii	12,251	35,388
Region 24.1	NRPS	64,249	108,631	Low	SF2768	NRPS:Type I
Region 28.1	T1PKS	1	53,344	High	macbecin/macbecin II	PKS
Region 28.2	T1PKS	92,169	116,556	Low	maytansine/ansamitocin P-3	PKS
Region 29.1	terpene	1	12,819
Region 31.1	opine-like-metallophore	1	18,268	Low	bacillopaline	other:other
Region 32.1	hydrogen-cyanide	1	9,483
Region 32.2	bottromycin	21,356	42,174	High	bottromycin A2	ribosomal:RiPP:Bottromycin
Region 35.1	NRPS-like,T1PKS,NRPS	1	77,135	Low	ansamitocin P-3	PKS
Region 36.1	lassopeptide	6,080	28,543	Low	felipeptin A2/felipeptin A1	ribosomal:RiPP
Region 41.1	T1PKS,NRPS	1	47,579	Low	amipurimycin	PKS
Region 57.1	lassopeptide	1	9,529

No secondary metabolite regions were found in these records:: BAAATP010000002.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000003.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000004.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000008.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000014.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000018.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000020.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000021.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000022.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000025.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000026.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000027.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000030.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000033.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000034.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000037.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000038.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000039.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000040.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000042.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000043.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000044.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000045.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000046.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000047.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000048.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000049.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000050.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000051.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000052.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000053.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000054.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000055.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000056.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000058.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000059.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000060.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000061.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000062.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000063.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000064.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000065.1 (Actinosynnema pretiosum subsp. pretiosum); BAAATP010000066.1 (Actinosynnema pretiosum subsp. pretiosum)

Compact view

BAAATP010000001.1 - Region 1 - NRPS-like,T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 160,632 - 219,859 nt. (total: 59,228 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GCM10010428_01650: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_01830: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: glycosyltransferase

GCM10010428_01730: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

GCM10010428_01720: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

GCM10010428_01660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_01690: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_01700: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.17	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.97	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.92	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.92	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.90	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.88	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001276.3	0.88	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.88	PKS	asperlactone	Aspergillus ochraceus
BGC0002286.3	0.88	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001275.3	0.87	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.31 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.85 out of 23.79

Confidence: medium

Additional weak hits (26):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.83 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.14 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.94 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.11 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.57 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.65 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.24 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.76 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.26 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.32 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.35 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.81 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.54 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.07 out of 32.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.17 out of 32.93

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 160631 - 219859:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 160631 - 202413:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 168337 - 219859:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal) + (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_01660: X

AMP-binding (10..391): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWSVGAVCK
Nearest Stachelhaus code(s):: Trp DAWSVGSVCK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

GCM10010428_01690: mal

PKS_AT (1262..1551): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 81.1
Methoxymalonyl-CoA: 35.6
Methylmalonyl-CoA: 28.2
inactive: 27.3
CHC-CoA: 10.5
2-Methylbutyryl-CoA: 10.3
Benzoyl-CoA: 9.8
Propionyl-CoA: 8.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10010428_01700: pk

PKS_AT (601..807): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 16.5
3-Methylbutyryl-CoA: 9.0
Malonyl-CoA: 4.8
Methylmalonyl-CoA: 0.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000001.1 - Region 2 - ectoine

Download region GenBank file

Download region SVG

Location: 295,885 - 306,259 nt. (total: 10,375 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

GCM10010428_02390: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000859.3	0.50	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.49	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.49	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.49	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.48	other (other)	ectoine	Methylarcula marina
BGC0000375.5	0.46	NRPS	indigoidine	Streptomyces chromofuscus
BGC0002295.3	0.46	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0000854.3	0.43	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0002301.2	0.36	PKS	(P)-ustilaginoidin A	Aschersonia paraphysata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000859.3	0.50	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.49	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.49	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.49	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.48	other (other)	ectoine	Methylarcula marina
BGC0000375.5	0.46	NRPS	indigoidine	Streptomyces chromofuscus
BGC0002295.3	0.46	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0000854.3	0.43	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0002301.2	0.36	PKS	(P)-ustilaginoidin A	Aschersonia paraphysata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.66 out of 23.43

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.84 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.75 out of 23.43

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
DosR	Hypoxia stress response regulator
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000001.1 - Region 3 - betalactone

Download region GenBank file

Download region SVG

Location: 435,173 - 463,032 nt. (total: 27,860 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

GCM10010428_03680: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10010428_03700: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10010428_03770: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: aminotransferase kinase

GCM10010428_03720: aminotransferase

smcogs: SMCOG1019: aminotransferase

GCM10010428_03760: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Ligases: ligase synthase

GCM10010428_03730: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_03800: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.56	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001166.5	0.55	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.56	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001166.5	0.55	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.67 out of 20.97

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.74 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.75 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.63 out of 28.19

Confidence: medium

Additional weak hits (14):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.11 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.24 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.96 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.36 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.95 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.64 out of 27.04

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
MexT	Global virulence regulator
OsdR	Development and stress management regulator
ZuR variant 1	Zinc-responsive repressor

BAAATP010000001.1 - Region 4 - T1PKS

Download region GenBank file

Download region SVG

Location: 488,097 - 595,818 nt. (total: 107,722 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GCM10010428_04100: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GCM10010428_04330: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase aminotransferase

GCM10010428_04240: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

GCM10010428_04300: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

GCM10010428_04310: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

GCM10010428_04190: thioesterase

smcogs: SMCOG1004: thioesterase

GCM10010428_04260: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

GCM10010428_04230: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

GCM10010428_04250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_04280: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_04290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_04350: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000142.3	0.65	PKS	salinilactam	Salinispora tropica CNB-440
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000142.3	0.65	PKS	salinilactam	Salinispora tropica CNB-440
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.16 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (61):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.12 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.51 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.01 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.28 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.37 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.71 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.44 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.92 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.26 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.84 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.11 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.18 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.77 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.77 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.06 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.58 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.88 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.32 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.76 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.86 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.28 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.25 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.75 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.08 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.18 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.33 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.79 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.37 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.91 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.06 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.56 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.99 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.42 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.00 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.09 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.12 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.09 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.09 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.00 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.01 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.46 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.68 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.61 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.00 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.49 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.31 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 488096 - 595818:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - Me-ccmal - Me-ccmal - ccmal) + (ccmal) + (ohmal - ohmal) + (Me-ohmal) + (ccmal - ccmal - ccmal)
Non-colinear ordering:: GCM10010428_04350 + GCM10010428_04220 + GCM10010428_04230 + GCM10010428_04240 + GCM10010428_04250

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_04220: mal

PKS_AT (567..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.5
inactive: 87.5
Methoxymalonyl-CoA: 55.9
Methylmalonyl-CoA: 46.9
Propionyl-CoA: 27.6
Acetyl-CoA: 22.4
Benzoyl-CoA: 18.3
Ethylmalonyl-CoA: 15.4
2-Methylbutyryl-CoA: 15.3
Isobutyryl-CoA: 14.3
CHC-CoA: 7.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10010428_04230: mal - mal

PKS_AT (549..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.6
inactive: 90.0
Methoxymalonyl-CoA: 61.1
Methylmalonyl-CoA: 51.4
Propionyl-CoA: 40.5
Isobutyryl-CoA: 26.1
Ethylmalonyl-CoA: 23.9
Acetyl-CoA: 22.8
Benzoyl-CoA: 22.4
fatty_acid: 8.8
CHC-CoA: 7.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -2.9

PKS_AT (2056..2327): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.1
inactive: 95.1
Methoxymalonyl-CoA: 62.2
Methylmalonyl-CoA: 51.8
Propionyl-CoA: 44.2
Isobutyryl-CoA: 26.8
Acetyl-CoA: 23.7
Ethylmalonyl-CoA: 23.1
2-Methylbutyryl-CoA: 21.5
Benzoyl-CoA: 21.1
fatty_acid: 11.8
CHC-CoA: 10.6
trans-1,2-CPDA: 10.2
3-Methylbutyryl-CoA: 0.0

GCM10010428_04240: mmal

PKS_AT (551..847): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 191.8
Ethylmalonyl-CoA: 182.5
Methoxymalonyl-CoA: 157.5
2-Methylbutyryl-CoA: 118.9
trans-1,2-CPDA: 100.9
Isobutyryl-CoA: 91.2
Propionyl-CoA: 86.5
Malonyl-CoA: 85.8
CHC-CoA: 70.6
Benzoyl-CoA: 64.1
Acetyl-CoA: 59.8
3-Methylbutyryl-CoA: 54.6
inactive: 28.2
fatty_acid: 10.9

GCM10010428_04250: mal - mal - mal

PKS_AT (564..851): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.0
inactive: 101.1
Methoxymalonyl-CoA: 64.0
Methylmalonyl-CoA: 58.5
Propionyl-CoA: 28.6
Isobutyryl-CoA: 28.4
Ethylmalonyl-CoA: 28.0
Benzoyl-CoA: 23.6
2-Methylbutyryl-CoA: 21.2
Acetyl-CoA: 17.1
CHC-CoA: 11.9
trans-1,2-CPDA: 8.3
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2238..2524): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.6
inactive: 102.8
Methoxymalonyl-CoA: 64.8
Methylmalonyl-CoA: 57.4
Propionyl-CoA: 37.3
Isobutyryl-CoA: 29.7
Ethylmalonyl-CoA: 25.6
Benzoyl-CoA: 21.0
Acetyl-CoA: 17.5
trans-1,2-CPDA: 13.4
fatty_acid: 8.7
CHC-CoA: 7.2
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -1.0

PKS_AT (3921..4199): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.0
inactive: 91.4
Methoxymalonyl-CoA: 69.0
Methylmalonyl-CoA: 57.0
Propionyl-CoA: 38.0
Isobutyryl-CoA: 34.8
Ethylmalonyl-CoA: 31.0
Benzoyl-CoA: 24.0
Acetyl-CoA: 19.4
CHC-CoA: 12.7
fatty_acid: 11.1
trans-1,2-CPDA: 8.1
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -0.3

GCM10010428_04280: X

AMP-binding (23..432): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFLDLSCVAK
Nearest Stachelhaus code(s):: Gly DILQLGCVWK (44% 8Å match); Ile or Val DFLCLGVVIK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10010428_04290: X

AMP-binding (18..415): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DCFFLAIITK
Nearest Stachelhaus code(s):: Ala DCFFFALITK (79% 8Å match); bMe-Asp DCFFFALITK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

GCM10010428_04300: pk

PKS_AT (46..267): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

GCM10010428_04350: mal - mmal - mmal - mal

PKS_AT (672..973): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.5
inactive: 107.0
Methoxymalonyl-CoA: 56.2
Methylmalonyl-CoA: 41.6
Isobutyryl-CoA: 28.6
Acetyl-CoA: 22.1
Propionyl-CoA: 17.9
Ethylmalonyl-CoA: 16.8
Benzoyl-CoA: 11.9
2-Methylbutyryl-CoA: 4.6
CHC-CoA: 1.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2410..2705): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 188.3
Ethylmalonyl-CoA: 186.0
Methoxymalonyl-CoA: 153.5
trans-1,2-CPDA: 119.6
2-Methylbutyryl-CoA: 104.6
CHC-CoA: 87.0
Propionyl-CoA: 80.0
Malonyl-CoA: 78.9
Isobutyryl-CoA: 63.4
3-Methylbutyryl-CoA: 50.0
Benzoyl-CoA: 47.9
Acetyl-CoA: 42.0
fatty_acid: 41.7
inactive: 20.1

PKS_AT (4133..4428): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.3
Ethylmalonyl-CoA: 203.5
Methoxymalonyl-CoA: 172.1
trans-1,2-CPDA: 134.9
2-Methylbutyryl-CoA: 125.9
Malonyl-CoA: 97.1
CHC-CoA: 95.6
Propionyl-CoA: 90.9
Isobutyryl-CoA: 80.6
Benzoyl-CoA: 52.9
3-Methylbutyryl-CoA: 47.3
Acetyl-CoA: 36.0
fatty_acid: 28.3
inactive: 21.1

PKS_AT (5845..6136): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Isobutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.7
inactive: 90.2
Methoxymalonyl-CoA: 64.9
Methylmalonyl-CoA: 62.1
Propionyl-CoA: 58.7
Isobutyryl-CoA: 31.8
Ethylmalonyl-CoA: 31.7
2-Methylbutyryl-CoA: 26.1
fatty_acid: 22.1
Acetyl-CoA: 20.7
Benzoyl-CoA: 20.3
CHC-CoA: 10.9
trans-1,2-CPDA: 6.1
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000001.1 - Region 5 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 596,751 - 657,455 nt. (total: 60,705 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10010428_04620: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

GCM10010428_04820: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

GCM10010428_04560: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

GCM10010428_04790: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

GCM10010428_04810: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

GCM10010428_04670: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_04800: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000392.5	0.96	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.58	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.58	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.58	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000343.5	0.58	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001261.3	0.57	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000392.5	0.78	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000343.5	0.62	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.53 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 30.11

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.49 out of 29.65

Confidence: medium

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.34 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.91 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.35 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.87 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.83 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.85 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.15 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 36.53

Confidence: weak

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 17.94 out of 23.05

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 596750 - 657455:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_04670: Fo-OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (940..1336): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWNVGAVNK
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWNVGAVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

GCM10010428_04800: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (62..472): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: PMPGLGVVCK
Nearest Stachelhaus code(s):: diOH-Bz PMPGLGVVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
LexA variant 1	Repressor of DNA damage response

BAAATP010000001.1 - Region 6 - nucleoside

Download region GenBank file

Download region SVG

Location: 734,196 - 755,185 nt. (total: 20,990 nt) Show pHMM detection rules used

nucleoside: (LipM or LipV or LipU or TunD or pur6 or pur10 or nikJ or nikO or truD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase methyltransferase

GCM10010428_05770: methyltransferase

smcogs: SMCOG1089: methyltransferase

GCM10010428_05810: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: dehydratase

GCM10010428_05780: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

GCM10010428_05830: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000880.4	0.69	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0000786.3	0.46	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000707.5	0.45	saccharide	kasugamycin	Streptomyces kasugaensis
BGC0000777.3	0.45	saccharide	lipopolysaccharide	Escherichia coli
BGC0002553.2	0.45	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000916.5	0.43	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002316.2	0.43	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000778.3	0.42	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0001374.5	0.42	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001927.4	0.42	other (other)	A-94964	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000880.4	0.69	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0000786.3	0.46	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000707.5	0.45	saccharide	kasugamycin	Streptomyces kasugaensis
BGC0000777.3	0.45	saccharide	lipopolysaccharide	Escherichia coli
BGC0002553.2	0.45	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000916.5	0.43	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002316.2	0.43	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000778.3	0.42	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0001374.5	0.42	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001927.4	0.42	other (other)	A-94964	Streptomyces sp.

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.37 out of 19.26

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

BAAATP010000005.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 385,160 - 396,008 nt. (total: 10,849 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

GCM10010428_23780: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.29	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.26	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.29	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.26	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.47 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

BAAATP010000006.1 - Region 1 - NRPS,azoxy-crosslink,nucleoside

Download region GenBank file

Download region SVG

Location: 158,956 - 310,830 nt. (total: 151,875 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)
nucleoside: (LipM or LipV or LipU or TunD or pur6 or pur10 or nikJ or nikO or truD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidoreductase oxygenase

GCM10010428_25720: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

GCM10010428_25820: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_26060: flavodoxin

smcogs: SMCOG1134: flavodoxin

GCM10010428_26080: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

GCM10010428_26120: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_26310: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

GCM10010428_26320: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GCM10010428_26360: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GCM10010428_26430: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

GCM10010428_26440: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_26620: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase aminotransferase glycosyltransferase methyltransferase

GCM10010428_26300: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GCM10010428_26390: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

GCM10010428_26470: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

GCM10010428_26520: methyltransferase

smcogs: SMCOG1089: methyltransferase

GCM10010428_26560: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deaminase hydrolase protease

GCM10010428_25680: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

GCM10010428_25730: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

GCM10010428_25910: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

GCM10010428_26460: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: dehydratase

GCM10010428_26230: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

GCM10010428_25840: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_25870: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_25880: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

GCM10010428_26140: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_26380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_26410: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_26420: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

GCM10010428_26250: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	1.40	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.38	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	1.37	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	1.26	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.23	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	1.21	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	1.18	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	1.17	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	1.10	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	1.05	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001841.2	0.81	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.71 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.20 out of 26.33

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.39 out of 27.04

Confidence: medium

Additional weak hits (68):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.58 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.48 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.44 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.86 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.19 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.22 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.47 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.37 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.03 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.21 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.30 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.46 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.38 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.50 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.46 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.99 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.26 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.27 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.44 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.43 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.67 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.47 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.97 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.63 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.46 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.74 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 14.98 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.10 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.94 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.01 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.87 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.62 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.77 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.08 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.65 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.51 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.46 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.24 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.41 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.96 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.13 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.89 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.66 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.43 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.31 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.93 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.89 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.08 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.11 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.45 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.24 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.59 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.92 out of 27.04

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.41 out of 32.93

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 158955 - 310830:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Val) + (X - X) + (X - Thr - Thr - Pro - Phe - NMe-Tyr - Val) + (Val) + (Val - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 158955 - 212583:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Thr - Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 203421 - 268432:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Thr - Thr - Pro - Phe - NMe-Tyr - Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 258591 - 310830:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Pro) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_25830: Thr - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (518..920): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1570..1960): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DALMQAVVWK
Nearest Stachelhaus code(s):: Phe DAYVGAAVWK (59% 8Å match); Dpr DAQDLAVVNK (53% 8Å match); aIle DALVFGVVLK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10010428_25840: X - X

AMP-binding (462..842): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DADNIGAVTK
Nearest Stachelhaus code(s):: Arg DAEDIGAITK (68% 8Å match); Tyr DAMSIGAVIK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1537..1922): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAEEVGSIAK
Nearest Stachelhaus code(s):: Arg DAEGVGAIAK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

GCM10010428_25870: X

AMP-binding (2..395): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DARLASQMTK
Nearest Stachelhaus code(s):: Glu DPRSLSQMAK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10010428_26140: X - Thr - Thr - Pro - Phe - Tyr - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (500..970): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DADEVGHVDK
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1792..2189): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2845..3240): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3893..4295): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQYAAHVVK
Nearest Stachelhaus code(s):: Pro DVQYAAHVVK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4951..5317): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAAVCK
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5965..6324): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (7465..7844): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYVIAAVYK
Nearest Stachelhaus code(s):: Ala DVWVIAAVIK (71% 8Å match); Phe DAYVGAAVWK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

GCM10010428_26380: X

AMP-binding (23..464): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VLPHLGGSTK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

GCM10010428_26410: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (468..847): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAHFLGGLYK
Nearest Stachelhaus code(s):: Val DALFLGGTFK (59% 8Å match); Ile DAMFLGCTYK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

GCM10010428_26420: Val - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (9..383): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFVGGTFK
Nearest Stachelhaus code(s):: Val DAFFVGGTFK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (960..1338): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000007.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 70,084 - 92,333 nt. (total: 22,250 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10010428_27650: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Lyases: cyclase

GCM10010428_27600: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: transporter

GCM10010428_27530: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002690.2	0.35	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002285.2	0.35	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001810.3	0.33	PKS	trehangelin	Polymorphospora rubra
BGC0000821.5	0.33	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001735.5	0.33	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000495.5	0.33	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002697.3	0.31	NRPS, PKS	clipibicyclene, azabicyclene B, azabicyclene C, azabicyclene D	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001647.3	0.31	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002690.2	0.35	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002285.2	0.35	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001810.3	0.33	PKS	trehangelin	Polymorphospora rubra
BGC0000821.5	0.33	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001735.5	0.33	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000495.5	0.33	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002697.3	0.31	NRPS, PKS	clipibicyclene, azabicyclene B, azabicyclene C, azabicyclene D	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001647.3	0.31	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

GCM10010428_27600: T1TS + T1TS

Domain 1 (2 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (330 - 699): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.54 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.10 out of 20.01

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.90 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.87 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.55 out of 27.18

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

BAAATP010000009.1 - Region 1 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 1 - 57,762 nt. (total: 57,762 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GCM10010428_32940: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_32950: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

GCM10010428_32970: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

GCM10010428_33020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase methyltransferase

GCM10010428_32800: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GCM10010428_32910: aminotransferase

smcogs: SMCOG1019: aminotransferase

GCM10010428_32960: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Ligases: synthase synthetase

GCM10010428_32820: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_32830: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

GCM10010428_32840: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_32990: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.43	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002631.2	0.42	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001336.5	0.35	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001485.4	0.34	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000677.5	0.33	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000041.3	0.32	PKS	oronofacic acid	Pseudomonas syringae
BGC0001012.3	0.32	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001529.5	0.31	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001911.3	0.31	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.31	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GCM10010428_32930: T2TS

Domain 1 (282 - 553): Type 2 terpene synthase

Subtype: unknown

GCM10010428_32990: PT_FPPS_like

Domain 1 (295 - 578): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.96 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.03 out of 26.33

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.22 out of 27.04

Confidence: medium

Additional weak hits (8):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.10 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.22 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.28 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.28 out of 26.85

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.29 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 11.66 out of 26.06

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.30 out of 24.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 57762:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal) + (ccmal - ohmal) + (ccmal)
Non-colinear ordering:: GCM10010428_32820 + GCM10010428_32830 + GCM10010428_32840

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 51170:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal) + (ccmal - ohmal) + (ccmal)
Non-colinear ordering:: GCM10010428_32820 + GCM10010428_32830 + GCM10010428_32840

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_32820: mal - mal - mal

PKS_AT (546..810): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 164.4
inactive: 67.6
Methylmalonyl-CoA: 55.1
Methoxymalonyl-CoA: 55.1
Propionyl-CoA: 34.4
Acetyl-CoA: 30.9
Isobutyryl-CoA: 28.0
Ethylmalonyl-CoA: 22.2
fatty_acid: 21.4
Benzoyl-CoA: 19.6
CHC-CoA: 18.2
2-Methylbutyryl-CoA: 16.1
trans-1,2-CPDA: 14.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (1517..1781): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 162.7
inactive: 83.8
Methoxymalonyl-CoA: 50.7
Methylmalonyl-CoA: 36.3
Propionyl-CoA: 19.2
Isobutyryl-CoA: 13.0
Acetyl-CoA: 11.9
fatty_acid: 9.5
Ethylmalonyl-CoA: 6.4
2-Methylbutyryl-CoA: 2.7
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
CHC-CoA: -3.8

PKS_AT (3165..3459): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.4
inactive: 93.6
Methoxymalonyl-CoA: 56.1
Methylmalonyl-CoA: 49.6
Propionyl-CoA: 37.5
Isobutyryl-CoA: 24.6
Ethylmalonyl-CoA: 16.2
CHC-CoA: 15.1
Benzoyl-CoA: 9.6
Acetyl-CoA: 8.4
2-Methylbutyryl-CoA: 8.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10010428_32830: mal - mal

PKS_AT (537..800): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 166.5
Methoxymalonyl-CoA: 77.0
inactive: 69.1
Methylmalonyl-CoA: 62.6
Isobutyryl-CoA: 32.0
Propionyl-CoA: 31.7
Benzoyl-CoA: 30.9
Acetyl-CoA: 29.7
Ethylmalonyl-CoA: 26.5
fatty_acid: 16.9
trans-1,2-CPDA: 16.2
CHC-CoA: 14.4
2-Methylbutyryl-CoA: 8.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2089..2362): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 156.7
Methoxymalonyl-CoA: 70.8
Methylmalonyl-CoA: 66.7
inactive: 56.8
Propionyl-CoA: 33.1
Isobutyryl-CoA: 26.3
Acetyl-CoA: 25.6
Benzoyl-CoA: 25.4
Ethylmalonyl-CoA: 25.0
CHC-CoA: 16.8
fatty_acid: 14.6
trans-1,2-CPDA: 11.6
2-Methylbutyryl-CoA: 10.7
3-Methylbutyryl-CoA: 0.0

GCM10010428_32840: mal

PKS_AT (552..837): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.1
inactive: 90.1
Methoxymalonyl-CoA: 56.2
Methylmalonyl-CoA: 37.7
Propionyl-CoA: 20.0
Acetyl-CoA: 15.0
Isobutyryl-CoA: 14.0
fatty_acid: 10.5
trans-1,2-CPDA: 9.1
2-Methylbutyryl-CoA: 8.8
Benzoyl-CoA: 8.6
Ethylmalonyl-CoA: 7.8
CHC-CoA: 7.3
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000009.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 65,459 - 131,700 nt. (total: 66,242 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GCM10010428_33190: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10010428_33300: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10010428_33310: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: acetyltransferase glycosyltransferase methyltransferase

GCM10010428_33160: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

GCM10010428_33270: methyltransferase

smcogs: SMCOG1248: methyltransferase

GCM10010428_33280: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

GCM10010428_33290: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: hydratase

GCM10010428_33150: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

GCM10010428_33170: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_33320: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_33350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002277.2	0.60	NRPS	atromentin	Suillus grevillei
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000067.5	0.54	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002277.2	0.60	NRPS	atromentin	Suillus grevillei
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000067.5	0.54	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (29):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.90 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.90 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.25 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 11.55 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.48 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.33 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.67 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.65 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.13 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.83 out of 25.75

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.65 out of 19.26

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.71 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.35 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.01 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.11 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.86 out of 36.53

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.01 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.40 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.96 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 11.68 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.52 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.83 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.75 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.03 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 65458 - 131700:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Me-ohmal)
Non-colinear ordering:: GCM10010428_33300 + GCM10010428_33330

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_33170: X

AMP-binding (21..472): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IALF---FEK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

GCM10010428_33300: mmal - mmal - mmal

PKS_AT (86..380): mmal

ATSignature: Isobutyryl-CoA

Top 3 matches:: Isobutyryl-CoA: 75.0%; 2-Methylbutyryl-CoA: 70.8%; Propionyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 148.8
Methoxymalonyl-CoA: 131.1
Ethylmalonyl-CoA: 131.1
2-Methylbutyryl-CoA: 124.3
CHC-CoA: 107.4
Propionyl-CoA: 102.7
Malonyl-CoA: 86.7
trans-1,2-CPDA: 82.3
Isobutyryl-CoA: 59.6
Benzoyl-CoA: 48.7
3-Methylbutyryl-CoA: 39.0
inactive: 32.9
Acetyl-CoA: 26.9
fatty_acid: 17.9

PKS_AT (1032..1241): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 61.1
Methoxymalonyl-CoA: 55.5
Ethylmalonyl-CoA: 47.5
2-Methylbutyryl-CoA: 44.5
Propionyl-CoA: 40.2
trans-1,2-CPDA: 39.1
CHC-CoA: 36.6
Isobutyryl-CoA: 23.5
Benzoyl-CoA: 21.5
Malonyl-CoA: 18.4
Acetyl-CoA: 16.6
3-Methylbutyryl-CoA: 13.1
fatty_acid: 11.6
inactive: 0.0

PKS_AT (1918..2211): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 66.7%; Malonyl-CoA: 62.5%; Methoxymalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 133.5
Methoxymalonyl-CoA: 120.5
Ethylmalonyl-CoA: 112.2
Malonyl-CoA: 102.9
2-Methylbutyryl-CoA: 74.2
trans-1,2-CPDA: 67.8
CHC-CoA: 64.9
Propionyl-CoA: 59.2
Isobutyryl-CoA: 53.6
Benzoyl-CoA: 40.9
inactive: 36.8
fatty_acid: 34.8
Acetyl-CoA: 22.6
3-Methylbutyryl-CoA: 16.7

GCM10010428_33330: mmal - mal

PKS_AT (1039..1331): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA, 2-Methylbutyryl-CoA

Top 3 matches:: Methylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%; 2-Methylbutyryl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 147.6
Ethylmalonyl-CoA: 143.8
Methoxymalonyl-CoA: 130.0
2-Methylbutyryl-CoA: 124.3
Propionyl-CoA: 103.8
trans-1,2-CPDA: 102.6
CHC-CoA: 81.8
Malonyl-CoA: 76.1
Benzoyl-CoA: 46.4
Isobutyryl-CoA: 36.5
Acetyl-CoA: 36.5
3-Methylbutyryl-CoA: 25.6
inactive: 18.7
fatty_acid: 16.7

PKS_AT (2680..2971): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 126.8
Methoxymalonyl-CoA: 59.1
Methylmalonyl-CoA: 56.9
Propionyl-CoA: 44.3
inactive: 34.1
CHC-CoA: 27.5
2-Methylbutyryl-CoA: 25.3
fatty_acid: 21.6
Acetyl-CoA: 20.8
Ethylmalonyl-CoA: 20.0
trans-1,2-CPDA: 14.6
Benzoyl-CoA: 12.0
Isobutyryl-CoA: 8.9
3-Methylbutyryl-CoA: 0.0

GCM10010428_33350: X

AMP-binding (12..380): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QVEVLSGTIK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

BAAATP010000010.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 131,756 - 152,826 nt. (total: 21,071 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10010428_36400: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Lyases: decarboxylase

GCM10010428_36370: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: synthetase

GCM10010428_36390: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.46	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.44	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.44	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000649.3	0.43	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000936.5	0.37	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.46	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.44	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.44	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000649.3	0.43	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000936.5	0.37	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GCM10010428_36390: PT_FPPS_like

Domain 1 (46 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.08 out of 23.79

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.24 out of 29.65

Confidence: medium

Additional weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.78 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.72 out of 24.78

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 30.11

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response

BAAATP010000010.1 - Region 2 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 217,452 - 240,016 nt. (total: 22,565 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

GCM10010428_37310: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acylase

GCM10010428_37170: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

GCM10010428_37180: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GCM10010428_37200: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000551.5	0.58	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000496.5	0.57	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.55	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.55	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.55	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000551.5	0.58	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000496.5	0.57	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.55	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.55	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.55	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

Additional weak hits (9):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.14 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.89 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.39 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.63 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.04 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.99 out of 26.33

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 19.26

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.35 out of 26.85

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

BAAATP010000011.1 - Region 1 - indole

Download region GenBank file

Download region SVG

Location: 43,041 - 64,117 nt. (total: 21,077 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10010428_38490: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

GCM10010428_38540: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GCM10010428_38550: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Translocases: permease

GCM10010428_38510: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.50	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002128.3	0.48	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001483.4	0.48	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0000706.3	0.40	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001267.3	0.39	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000671.3	0.38	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.50	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002128.3	0.48	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001483.4	0.48	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0000706.3	0.40	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001267.3	0.39	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000671.3	0.38	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.07 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.28 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

BAAATP010000012.1 - Region 1 - 2dos,NRPS,PKS-like

Download region GenBank file

Download region SVG

Location: 2,607 - 67,839 nt. (total: 65,233 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)
2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

GCM10010428_40810: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

GCM10010428_40850: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

GCM10010428_40880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10010428_40890: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GCM10010428_40940: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

GCM10010428_41090: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: carboxylase methyltransferase sulfhydrylase

GCM10010428_40760: methyltransferase

smcogs: SMCOG1089: methyltransferase

GCM10010428_40970: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

GCM10010428_41000: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: deaminase dehalogenase hydrolase

GCM10010428_40660: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GCM10010428_40770: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

GCM10010428_40950: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GCM10010428_41020: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

GCM10010428_40860: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

GCM10010428_40920: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

GCM10010428_40990: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

GCM10010428_41010: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

GCM10010428_41050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.72	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000895.5	0.59	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000701.5	0.58	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002510.2	0.56	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0002458.3	0.52	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0000723.5	0.47	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0002404.2	0.47	other (other)	falcarindiol	Solanum lycopersicum
BGC0000234.5	0.47	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002047.2	0.46	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000231.5	0.46	PKS	griseusin A, griseusin B	Streptomyces griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (11):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.05 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.11 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.16 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.65 out of 19.26

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.62 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 2606 - 67839:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 24671 - 67839:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_41050: X

AMP-binding (474..871): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMGGMGLIGK
Nearest Stachelhaus code(s):: E-ahmohOrn DVGGGGVIGK (50% 8Å match); OH-Orn DMENMGLINK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000012.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 116,334 - 173,868 nt. (total: 57,535 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10010428_41750: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

GCM10010428_41830: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10010428_41860: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acylase sulfhydrylase

GCM10010428_41820: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

GCM10010428_41850: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

GCM10010428_41690: thioesterase

smcogs: SMCOG1004: thioesterase

GCM10010428_41790: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000016.4	0.57	other (other)	amphotericin B	Streptomyces nodosus
BGC0000843.5	0.43	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000815.4	0.42	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000467.5	0.41	NRPS	yersiniabactin	Yersinia enterocolitica
BGC0000122.5	0.41	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000899.4	0.40	saccharide	desosamine	Streptomyces narbonensis
BGC0000829.5	0.40	other (other)	violacein	Chromobacterium violaceum
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001513.3	0.39	PKS	anthrabenzoxocinone	Actinobacteria bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000016.4	0.57	other (other)	amphotericin B	Streptomyces nodosus
BGC0000843.5	0.43	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000815.4	0.42	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000467.5	0.41	NRPS	yersiniabactin	Yersinia enterocolitica
BGC0000122.5	0.41	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000899.4	0.40	saccharide	desosamine	Streptomyces narbonensis
BGC0000829.5	0.40	other (other)	violacein	Chromobacterium violaceum
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001513.3	0.39	PKS	anthrabenzoxocinone	Actinobacteria bacterium

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.53 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.67 out of 30.11

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.73 out of 30.22

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.82 out of 27.04

Confidence: medium

Additional weak hits (27):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.71 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.39 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.53 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.04 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.71 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 14.83 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.40 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.21 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.88 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.02 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.38 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.88 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.85 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.88 out of 32.93

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.84 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.86 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.32 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.82 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.57 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 30.11

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 116333 - 173868:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_41850: mal - mal - mmal - mal

PKS_AT (503..754): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 66.7%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 127.1
Methoxymalonyl-CoA: 80.9
Methylmalonyl-CoA: 61.9
inactive: 42.5
Isobutyryl-CoA: 42.4
Benzoyl-CoA: 28.0
Propionyl-CoA: 27.1
Acetyl-CoA: 26.7
Ethylmalonyl-CoA: 25.5
fatty_acid: 23.5
2-Methylbutyryl-CoA: 15.6
CHC-CoA: 12.9
trans-1,2-CPDA: 11.3
3-Methylbutyryl-CoA: 4.2

PKS_AT (1579..1822): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 62.5%; Ethylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.0
Methylmalonyl-CoA: 58.2
Propionyl-CoA: 55.5
Methoxymalonyl-CoA: 53.8
inactive: 37.9
CHC-CoA: 30.0
Ethylmalonyl-CoA: 27.3
Isobutyryl-CoA: 22.1
2-Methylbutyryl-CoA: 19.5
trans-1,2-CPDA: 18.9
fatty_acid: 13.6
Benzoyl-CoA: 13.5
Acetyl-CoA: 8.9
3-Methylbutyryl-CoA: 3.6

PKS_AT (3836..4047): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 84.7
Methoxymalonyl-CoA: 59.0
Ethylmalonyl-CoA: 46.8
trans-1,2-CPDA: 37.1
2-Methylbutyryl-CoA: 32.2
Isobutyryl-CoA: 30.7
Malonyl-CoA: 29.2
Propionyl-CoA: 28.9
Benzoyl-CoA: 26.0
CHC-CoA: 18.1
Acetyl-CoA: 17.5
fatty_acid: 14.8
inactive: 13.3
3-Methylbutyryl-CoA: 10.2

PKS_AT (4563..4809): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 106.5
Methoxymalonyl-CoA: 50.0
Methylmalonyl-CoA: 44.4
inactive: 41.9
Propionyl-CoA: 21.2
Isobutyryl-CoA: 19.1
Acetyl-CoA: 14.7
CHC-CoA: 14.6
fatty_acid: 13.4
Benzoyl-CoA: 13.3
Ethylmalonyl-CoA: 10.7
3-Methylbutyryl-CoA: 7.7
trans-1,2-CPDA: 6.5
2-Methylbutyryl-CoA: -1.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
ClgR	Caseinolytic protease gene regulator
DasR	N-acetylglucosamine dependent repressor

BAAATP010000012.1 - Region 3 - T1PKS

Download region GenBank file

Download region SVG

Location: 214,764 - 260,523 nt. (total: 45,760 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10010428_42350: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GCM10010428_42540: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

GCM10010428_42570: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

GCM10010428_42580: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

GCM10010428_42590: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

GCM10010428_42670: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

GCM10010428_42700: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: acylase aminotransferase methyltransferase

GCM10010428_42480: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

GCM10010428_42500: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

GCM10010428_42560: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase

GCM10010428_42640: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: dehydratase

GCM10010428_42530: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

GCM10010428_42660: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000056.3	0.55	PKS	esperamicin	Actinomadura verrucosospora
BGC0002387.2	0.51	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.46	PKS	uncialamycin	Streptomyces uncialis
BGC0000584.5	0.46	ribosomal	colicin V	Escherichia coli
BGC0002372.3	0.46	PKS, other (other), terpene	marinoterpin B, marinoterpin A, marinoterpin C	Streptomyces sp.
BGC0000265.5	0.45	PKS	rhodomycin	Streptomyces purpurascens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000056.3	0.55	PKS	esperamicin	Actinomadura verrucosospora
BGC0002387.2	0.51	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.46	PKS	uncialamycin	Streptomyces uncialis
BGC0000584.5	0.46	ribosomal	colicin V	Escherichia coli
BGC0002372.3	0.46	PKS, other (other), terpene	marinoterpin B, marinoterpin A, marinoterpin C	Streptomyces sp.
BGC0000265.5	0.45	PKS	rhodomycin	Streptomyces purpurascens

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.64 out of 26.85

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.86 out of 18.57

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.56 out of 23.79

Confidence: medium

Additional weak hits (16):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.17 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.88 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.18 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.18 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.44 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.52 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.15 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.24 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.04 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.08 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.07 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.91 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.42 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.23 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

GCM10010428_42560: mal

PKS_AT (612..846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 66.5
Methoxymalonyl-CoA: 46.4
Methylmalonyl-CoA: 34.5
inactive: 31.6
Propionyl-CoA: 25.4
Isobutyryl-CoA: 20.1
trans-1,2-CPDA: 13.6
fatty_acid: 11.1
Ethylmalonyl-CoA: 9.6
2-Methylbutyryl-CoA: 0.9
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

BAAATP010000013.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 26,267 nt. (total: 26,267 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

GCM10010428_43190: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Ligases: ligase

GCM10010428_43010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 36.54

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.88 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 25.75

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 26267:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_43010: X

AMP-binding (601..837): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ASVFVGASTK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

BAAATP010000013.1 - Region 2 - thioamitides

Download region GenBank file

Download region SVG

Location: 254,167 - 276,588 nt. (total: 22,422 nt) Show pHMM detection rules used

Region on contig edge.

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

GCM10010428_45760: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.53	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.39	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.35	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001802.5	0.34	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.34	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.33	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.30	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001474.4	0.29	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001471.5	0.28	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001473.4	0.28	ribosomal	Sch 18640	Micromonospora arborensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.53	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.39	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.35	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001802.5	0.34	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.34	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.33	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.30	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001474.4	0.29	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001471.5	0.28	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001473.4	0.28	ribosomal	Sch 18640	Micromonospora arborensis

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.87 out of 20.97

Confidence: strong

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.38 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.83 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.42 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.91 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

BAAATP010000015.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 59,500 - 107,166 nt. (total: 47,667 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

GCM10010428_49030: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

GCM10010428_49120: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_49170: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_49190: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: esterase hydrolase

GCM10010428_49180: thioesterase

smcogs: SMCOG1004: thioesterase

GCM10010428_49280: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

GCM10010428_49130: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_49140: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_49150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001050.5	0.67	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001050.5	0.67	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.16 out of 20.97

Confidence: medium

Additional weak hits (26):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.58 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.32 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.78 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.69 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.90 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.66 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.69 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.33 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.28 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.68 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.98 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.22 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.59 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.86 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.45 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.07 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.45 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 59499 - 107166:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_49140: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (664..1060): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code(s):: Val DALWLGGTFK (88% 8Å match); bOH-Val DALWLGGTFK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

GCM10010428_49150: mal

PKS_AT (672..939): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 16.3
Methoxymalonyl-CoA: 14.3
Methylmalonyl-CoA: 7.7
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

BAAATP010000015.1 - Region 2 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 135,035 - 190,847 nt. (total: 55,813 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GCM10010428_49910: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GCM10010428_49950: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

GCM10010428_50050: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GCM10010428_50130: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase

GCM10010428_50060: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Isomerases: racemase

GCM10010428_50020: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

GCM10010428_49970: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	1.12	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.80	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.75	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.71	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	0.82	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.68	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.45 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.17 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.44 out of 36.53

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (12):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.90 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.36 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.46 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.49 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.98 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.73 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.07 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.80 out of 28.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 135034 - 190847:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Fo-OH-Orn - Ser - OH-Orn - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_49970: Fo-OH-Orn - Ser - OH-Orn - X

Search NORINE for peptide: strict or relaxed

AMP-binding (424..798): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWIVGAVNK
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWIIGAVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1402..1781): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2426..2817): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DMENLGLINK
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3464..3855): X

nrpys: OH-Orn, Ac-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVFVLGAVNK
Nearest Stachelhaus code(s):: Ac-OH-Orn DVFALGAVNK (91% 8Å match); OH-Orn DVFILGAVNK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000015.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 207,717 - 228,757 nt. (total: 21,041 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10010428_50370: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GCM10010428_50490: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GCM10010428_50560: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: synthase synthetase

GCM10010428_50430: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

GCM10010428_50450: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000666.5	0.47	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000665.5	0.46	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000189.4	0.46	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0001529.5	0.42	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001156.5	0.42	terpene	platencin	Streptomyces platensis
BGC0000668.5	0.41	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000666.5	0.47	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000665.5	0.46	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000189.4	0.46	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0001529.5	0.42	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001156.5	0.42	terpene	platencin	Streptomyces platensis
BGC0000668.5	0.41	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GCM10010428_50450: PT_FPPS_like

Domain 1 (61 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

Additional weak hits (12):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.14 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.55 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.38 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.49 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.62 out of 29.38

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 30.11

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.69 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.11 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.92 out of 25.88

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

BAAATP010000016.1 - Region 1 - NRPS,T1PKS,betalactone,crocagin

Download region GenBank file

Download region SVG

Location: 30,350 - 161,590 nt. (total: 131,241 nt) Show pHMM detection rules used

crocagin: (PhyH and Carbam_trans_N)
betalactone: (HMGL-like and AMP-binding)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

GCM10010428_51040: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_51180: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_51270: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10010428_51530: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

GCM10010428_51690: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

GCM10010428_51740: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

GCM10010428_51800: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acyltransferase glycosyltransferase

GCM10010428_51190: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

GCM10010428_51550: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: esterase peptidase protease

GCM10010428_51370: thioesterase

smcogs: SMCOG1004: thioesterase

GCM10010428_51420: thioesterase

smcogs: SMCOG1004: thioesterase

GCM10010428_51610: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

GCM10010428_51760: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: lyase

GCM10010428_51570: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Isomerases: isomerase

GCM10010428_51640: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

GCM10010428_51680: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

GCM10010428_51010: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_51110: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

GCM10010428_51120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_51150: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

GCM10010428_51170: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

GCM10010428_51260: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_51320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_51340: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_51360: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_51380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_51390: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_51650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_51660: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.17	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000357.5	1.16	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001261.3	1.16	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	1.15	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	1.14	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.14	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.13	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	1.12	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001249.5	1.11	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	1.08	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000448.5	0.71	NRPS	tomaymycin	Streptomyces achromogenes
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.16 out of 26.33

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.85 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (33):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.78 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.33 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.82 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.28 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.80 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.28 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.55 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.17 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.46 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.62 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.33 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.31 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.59 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.90 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.03 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.16 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.46 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.64 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.47 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.29 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.93 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.46 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 30349 - 161590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Arg - X) + (ccmal) + (Gly) + (Gly) + (ccmal) + (X) + (X) + (Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 45942 - 122894:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal) + (Gly) + (Gly) + (ccmal) + (Arg - X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 97686 - 161590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (X) + (X) + (Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_51120: X

AMP-binding (12..379): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AALTNAGPLK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

GCM10010428_51260: mal

PKS_AT (541..826): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 77.3
Methoxymalonyl-CoA: 42.3
Methylmalonyl-CoA: 38.2
Propionyl-CoA: 34.4
inactive: 23.4
Isobutyryl-CoA: 23.4
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

GCM10010428_51320: Arg - X

Search NORINE for peptide: strict or relaxed

AMP-binding (2..400): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGDIGAVEK
Nearest Stachelhaus code(s):: Arg DVGDIGAVTK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1043..1421): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHVGAVAK
Nearest Stachelhaus code(s):: Asp DPRHVSLLAK (56% 8Å match); D-Asp DPRHVGIFIK (50% 8Å match); Leu DALLVGAVAK (47% 8Å match); Trp DVGMVGAVAK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

GCM10010428_51340: mal

PKS_AT (531..807): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 98.4
Methylmalonyl-CoA: 53.8
Propionyl-CoA: 49.9
Methoxymalonyl-CoA: 47.7
2-Methylbutyryl-CoA: 39.3
inactive: 34.4
CHC-CoA: 26.9
Ethylmalonyl-CoA: 26.7
trans-1,2-CPDA: 19.7
Benzoyl-CoA: 19.5
Acetyl-CoA: 19.3
fatty_acid: 13.2
Isobutyryl-CoA: 13.1
3-Methylbutyryl-CoA: 0.0

GCM10010428_51360: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (451..835): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

GCM10010428_51380: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (460..838): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

GCM10010428_51390: mal

PKS_AT (545..824): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 118.2
Methoxymalonyl-CoA: 65.9
Methylmalonyl-CoA: 61.8
Propionyl-CoA: 51.8
inactive: 50.4
CHC-CoA: 37.5
2-Methylbutyryl-CoA: 30.5
Ethylmalonyl-CoA: 25.0
trans-1,2-CPDA: 19.4
fatty_acid: 16.1
Benzoyl-CoA: 13.5
Acetyl-CoA: 12.0
Isobutyryl-CoA: 8.1
3-Methylbutyryl-CoA: 0.0

GCM10010428_51550: X

AMP-binding (474..865): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLKVGSVLK
Nearest Stachelhaus code(s):: Glu DVLKVGAVNK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

GCM10010428_51560: X

AMP-binding (80..469): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSHEIGGVAK
Nearest Stachelhaus code(s):: Lys DVFESGGVAK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

GCM10010428_51650: X

AMP-binding (5..398): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAISLSGTIK
Nearest Stachelhaus code(s):: diOH-Bz AANFVSGAIK (62% 8Å match); mxAnt AATHLSATLK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10010428_51660: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (560..959): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVMYAVMLAK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000016.1 - Region 2 - CDPS

Download region GenBank file

Download region SVG

Location: 203,960 - 224,661 nt. (total: 20,702 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10010428_52270: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

GCM10010428_52300: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase synthase

GCM10010428_52280: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_52340: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000851.5	0.46	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001948.3	0.45	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001295.5	0.38	other (other)	cremeomycin	Streptomyces cremeus
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000218.5	0.38	PKS	doxorubicin	Streptomyces peucetius
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000851.5	0.46	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001948.3	0.45	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001295.5	0.38	other (other)	cremeomycin	Streptomyces cremeus
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000218.5	0.38	PKS	doxorubicin	Streptomyces peucetius
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.01 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.36 out of 26.06

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.20 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.81 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.11 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.47 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.51 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.14 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

GCM10010428_52280: X

AMP-binding (47..434): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAWEINGGMK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000017.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 17,010 - 39,907 nt. (total: 22,898 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10010428_52600: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

GCM10010428_52750: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

GCM10010428_52680: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.73	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.73	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.68	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.66	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0002298.2	0.63	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001781.4	0.59	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001889.2	0.56	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002150.2	0.56	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.56	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001548.4	0.56	ribosomal	citrulassin A	Streptomyces albulus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.73	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.73	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.68	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.66	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0002298.2	0.63	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001781.4	0.59	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001889.2	0.56	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002150.2	0.56	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.56	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001548.4	0.56	ribosomal	citrulassin A	Streptomyces albulus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.06 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.73 out of 20.97

Confidence: medium

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.54 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.20 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.78 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 85; Score: 88.2

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

BAAATP010000017.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 131,853 - 215,739 nt. (total: 83,887 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

GCM10010428_53790: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

GCM10010428_53840: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

GCM10010428_53940: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase protease

GCM10010428_53720: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

GCM10010428_53950: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase

GCM10010428_53900: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

GCM10010428_53670: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_53800: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_53810: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_53820: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_53850: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

GCM10010428_53910: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_53920: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001770.4	0.71	PKS	sceliphrolactam	Streptomyces sp. SD85
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001770.4	0.71	PKS	sceliphrolactam	Streptomyces sp. SD85
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.34 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (14):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.16 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.66 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.49 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.01 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.75 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.20 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.52 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.65 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.58 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 19.99 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.29 out of 30.98

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 131852 - 215739:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (Me-ccmal - ccmal) + (ccmal) + (ohmal) + (ccmal - Me-ccmal - ccmal) + (mal)
Non-colinear ordering:: GCM10010428_53850 + GCM10010428_53840 + GCM10010428_53820 + GCM10010428_53810 + GCM10010428_53800 + GCM10010428_53790

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_53790: mal

PKS_AT (557..835): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.3
inactive: 88.2
Methoxymalonyl-CoA: 52.8
Methylmalonyl-CoA: 50.9
Propionyl-CoA: 32.3
Isobutyryl-CoA: 20.2
Acetyl-CoA: 15.2
CHC-CoA: 12.2
Benzoyl-CoA: 10.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -0.5
2-Methylbutyryl-CoA: -2.2

GCM10010428_53800: mal - mmal - mal

PKS_AT (563..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.1
inactive: 111.7
Methoxymalonyl-CoA: 61.5
Methylmalonyl-CoA: 55.5
Propionyl-CoA: 35.2
Benzoyl-CoA: 30.3
Isobutyryl-CoA: 27.6
Ethylmalonyl-CoA: 25.5
2-Methylbutyryl-CoA: 19.0
Acetyl-CoA: 16.8
fatty_acid: 12.8
CHC-CoA: 9.5
trans-1,2-CPDA: 8.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (2262..2551): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.5
Ethylmalonyl-CoA: 198.2
Methoxymalonyl-CoA: 176.5
2-Methylbutyryl-CoA: 143.6
trans-1,2-CPDA: 116.6
CHC-CoA: 114.3
Propionyl-CoA: 114.1
Malonyl-CoA: 109.8
Isobutyryl-CoA: 84.1
Benzoyl-CoA: 66.2
Acetyl-CoA: 45.5
fatty_acid: 36.9
3-Methylbutyryl-CoA: 32.2
inactive: 28.3

PKS_AT (3937..4222): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.1
inactive: 66.2
Methoxymalonyl-CoA: 58.6
Methylmalonyl-CoA: 48.7
Propionyl-CoA: 37.4
fatty_acid: 19.4
Acetyl-CoA: 19.3
trans-1,2-CPDA: 15.3
CHC-CoA: 15.3
Benzoyl-CoA: 14.1
Isobutyryl-CoA: 13.3
Ethylmalonyl-CoA: 12.2
2-Methylbutyryl-CoA: 6.4
3-Methylbutyryl-CoA: 0.0

GCM10010428_53810: mal

PKS_AT (551..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.3
inactive: 114.8
Methoxymalonyl-CoA: 60.3
Methylmalonyl-CoA: 44.5
Isobutyryl-CoA: 39.9
Propionyl-CoA: 29.9
Ethylmalonyl-CoA: 19.4
Benzoyl-CoA: 18.2
Acetyl-CoA: 14.0
2-Methylbutyryl-CoA: 8.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10010428_53820: mal

PKS_AT (553..837): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.7
inactive: 76.5
Methoxymalonyl-CoA: 56.6
Methylmalonyl-CoA: 49.8
CHC-CoA: 21.2
Propionyl-CoA: 20.5
Ethylmalonyl-CoA: 20.4
Isobutyryl-CoA: 18.0
Benzoyl-CoA: 18.0
fatty_acid: 16.9
2-Methylbutyryl-CoA: 8.5
trans-1,2-CPDA: 8.2
3-Methylbutyryl-CoA: 0.0
Acetyl-CoA: -1.7

GCM10010428_53840: mmal - mal

PKS_AT (436..731): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 223.3
Ethylmalonyl-CoA: 214.2
Methoxymalonyl-CoA: 182.4
2-Methylbutyryl-CoA: 147.7
CHC-CoA: 120.1
trans-1,2-CPDA: 119.6
Propionyl-CoA: 111.2
Malonyl-CoA: 97.8
Isobutyryl-CoA: 90.6
Benzoyl-CoA: 71.1
3-Methylbutyryl-CoA: 53.7
Acetyl-CoA: 46.3
fatty_acid: 36.9
inactive: 23.8

PKS_AT (2130..2427): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.1
inactive: 108.6
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 48.3
Propionyl-CoA: 42.1
Acetyl-CoA: 13.3
Isobutyryl-CoA: 12.6
Benzoyl-CoA: 8.8
trans-1,2-CPDA: 8.1
CHC-CoA: 7.8
2-Methylbutyryl-CoA: 5.2
Ethylmalonyl-CoA: 2.1
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10010428_53850: mal - mal

PKS_AT (644..939): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.3
inactive: 88.5
Methoxymalonyl-CoA: 53.7
Methylmalonyl-CoA: 47.2
Isobutyryl-CoA: 27.7
Propionyl-CoA: 25.3
CHC-CoA: 21.7
Ethylmalonyl-CoA: 17.5
Benzoyl-CoA: 14.5
Acetyl-CoA: 13.9
fatty_acid: 11.0
2-Methylbutyryl-CoA: 8.3
trans-1,2-CPDA: 3.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (2313..2603): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.3
inactive: 110.4
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 53.1
Ethylmalonyl-CoA: 20.4
Acetyl-CoA: 20.0
Propionyl-CoA: 19.6
Isobutyryl-CoA: 16.3
Benzoyl-CoA: 11.5
fatty_acid: 9.6
2-Methylbutyryl-CoA: 8.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10010428_53910: X

AMP-binding (21..416): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DYYPTTQRVK
Nearest Stachelhaus code(s):: 3S-Abu DYYPTTQRIK (88% 8Å match); Asp DYYPTTMRVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

GCM10010428_53920: X

AMP-binding (21..419): X

nrpys: bMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DCFFFALITK
Nearest Stachelhaus code(s):: bMe-Asp DCFFFALITK (94% 8Å match); Ala DCFFFALITK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

GCM10010428_53940: pk

PKS_AT (39..290): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

BAAATP010000019.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 54,099 - 90,838 nt. (total: 36,740 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10010428_56450: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

GCM10010428_56510: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GCM10010428_56550: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GCM10010428_56610: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase

GCM10010428_56560: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: protease

GCM10010428_56370: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

GCM10010428_56420: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

GCM10010428_56410: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

GCM10010428_56520: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.70	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.65	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.60	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001361.3	0.58	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.58	terpene	sodorifen	Serratia plymuthica
BGC0000636.3	0.54	terpene	carotenoid	Brevibacterium linens
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0002309.2	0.50	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.70	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.65	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.60	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001361.3	0.58	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.58	terpene	sodorifen	Serratia plymuthica
BGC0000636.3	0.54	terpene	carotenoid	Brevibacterium linens
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0002309.2	0.50	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

GCM10010428_56420: T1TS

Domain 1 (4 - 288): Type 1 terpene synthase

Subtype: unknown

GCM10010428_56520: PT_FPPS_like

Domain 1 (50 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

GCM10010428_56530: PT_phytoene_like

Domain 1 (17 - 308): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

GCM10010428_56570: Lycopene_cycl

Domain 1 (11 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

GCM10010428_56580: Lycopene_cycl

Domain 1 (5 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.00 out of 23.79

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.86 out of 30.25

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.95 out of 29.51

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (13):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.54 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.38 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.93 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.81 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.38 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.21 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.58 out of 28.14

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.68 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.09 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ColR	Phenol-responsive regulator
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000019.1 - Region 2 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 114,844 - 141,907 nt. (total: 27,064 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

GCM10010428_56880: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000606.5	0.55	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0002311.3	0.46	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001174.4	0.45	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.42	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.41	ribosomal	kocurin	Kocuria rosea
BGC0000603.5	0.41	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001860.4	0.40	ribosomal	thiomuracin	Thermobispora bispora DSM 43833

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000606.5	0.55	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0002311.3	0.46	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001174.4	0.45	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.42	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.41	ribosomal	kocurin	Kocuria rosea
BGC0000603.5	0.41	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001860.4	0.40	ribosomal	thiomuracin	Thermobispora bispora DSM 43833

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (15):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.79 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.05 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.81 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.34 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.65 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.35 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.13 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.41 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.82 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.23 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 1 - 87; Score: 40.8

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

BAAATP010000023.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 12,251 - 35,388 nt. (total: 23,138 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10010428_61800: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

GCM10010428_61910: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Lyases: cyclase

GCM10010428_61870: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Translocases: transporter

GCM10010428_61830: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0001660.3	0.47	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001407.5	0.43	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0002699.2	0.43	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000527.5	0.43	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000517.4	0.41	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0001660.3	0.47	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001407.5	0.43	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0002699.2	0.43	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000527.5	0.43	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000517.4	0.41	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for GCM10010428_61870

allorf_013608_013844

Leader:

MALAGLRERVGDPVGA

Core:

GRKTTLVRCHAPKNRQTRCVTTGNGVQPSCNRRPSAFRPFRYPDAAGQIRNDPTALLITLRK

Core with dehydrations:

GRKDhbDhbLVRCysHAPKNRQDhbRCysVDhbDhbGNGVQPDhaCysNRRPDhaAFRPFRYPDAAGQIRNDPDhbALLIDhbLRK

antiSMASH-DB 4.0 matches for allorf_013608_013844

16.1%

NZ_GG657757.1and 1 other:

NZ_GG657757.1 Lanthipeptides: allorf_4712210_4712371_lanthipeptide

Lanthipeptides: allorf_4712210_4712371_lanthipeptide

36

AFRPFRYPDAAGQIRNDPTA

55

A RP RYP N PTA

12

ALRPVRYPACVLSSANQPTA

31

12.9%

NZ_AQRJ01000038.1and 1 other:

NZ_AQRJ01000038.1 Lanthipeptides: YW7_RS06850_lanthipeptide

Lanthipeptides: YW7_RS06850_lanthipeptide

20

VTTGNGVQPSCNRRPSAFRPF

40

+TG+G P+C SA F

5

CSTGDGCGPTCQGGASACNSF

25

12.9%

NZ_BKZV01000001.1:

Lanthipeptides: allorf_0679543_0679704_lanthipeptide

13

KNRQTRCVTTGN

24

KNR RC TGN

20

KNRGERCEKTGN

31

with 3 more sequence matches

12.9%

NZ_CP011131.1:

Lanthipeptides: allorf_2170870_2171055_lanthipeptide

13

KNRQTRCVTTGNGVQPSCNRR

33

+ R+ R + TG PS +RR

14

ETRRPRAIKTGGSPTPSLDRR

34

11.3%

NZ_CP054019.1:

Lanthipeptides: allorf_9072958_9073107_lanthipeptide

9

CHAPKNRQTRCVTTG

23

CHAP + Q ++TG

9

CHAPPHAQRESLSTG

23

11.3%

NZ_FNVU01000016.1and 1 other:

NZ_FNVU01000016.1 Lanthipeptides: C4U44_RS29500_lanthipeptide

Lanthipeptides: C4U44_RS29500_lanthipeptide

20

VTTGNGVQPSCNRRPSAFRPF

40

+TG+G +C+ SA F

5

CSTGDGCGSTCSNGASACNSF

25

MIBiG 4.0 matches for allorf_013608_013844

8.1%

BGC0001229.4 (SBI_06990):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

21

TTGNGVQPSCN

31

T QP+CN

29

TLSKECQPNCN

39

6.5%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

26

VQPSCN

31

QP+CN

25

CQPNCN

30

allorf_020464_020658

Leader:

MGGARSWRGEGSAGCRRSAGRRLGERALGWTGGRRDRVGGERGRVAVG

Core:

GCGRGARAGVTQASGG

Core with dehydrations:

GCysGRGARAGVDhbQADhaGG

allorf_026406_026564

Leader:

MGDERGRERRVGAGA

Core:

AMSERTVHSPCADTPARRTRQGSELGAGAVRSDAVRE

Core with dehydrations:

AMDhaERDhbVHDhaPCysADDhbPARRDhbRQGDhaELGAGAVRDhaDAVRE

antiSMASH-DB 4.0 matches for allorf_026406_026564

21.6%

NZ_FMHJ01000003.1:

Lanthipeptides: allorf_516193_516348_lanthipeptide

3

SERTVHSPCADTPARRTRQGS

23

+R ++ C P RR QGS

9

GKRLRNALCGGWPGRRAPQGS

29

21.6%

NZ_PSVM01000028.1:

Lanthipeptides: C5C86_RS17755_lanthipeptide

2

MSERTVHSPCADTPARRTR

20

+S +V SPC D P+ T

1

VSTFSVISPCPDWPSSITW

19

21.3%

NZ_CP029354.1:

Lanthipeptides: allorf_108572_108748_lanthipeptide

3

SERTVHSPCADTPARRTRQGS

23

+E+TVHSP DT A R + +

4

NEQTVHSPAPDTLAARMKHAA

24

with 2 more sequence matches

18.9%

NZ_LIVW01000002.1:

Lanthipeptides: allorf_0400297_0400458_lanthipeptide

11

CADTPARRTRQGSE

24

C TP +TRQ E

4

CRHTPPAKTRQNGE

17

10.9%

NZ_QFWW01000059.1:

Lanthipeptides: allorf_181082_181303_lanthipeptide

7

VHSPCADTPARR

18

V PC++TPA R

13

VRPPCSETPAAR

24

allorf_026894_027097

Leader:

MTIARWEGERRRVKGG

Core:

AGGGGGWLGPVGGAGGCERGELGGGGVMGVVAGGDGCWLSGELHPWLLCRP

Core with dehydrations:

AGGGGGWLGPVGGAGGCysERGELGGGGVMGVVAGGDGCysWLDhaGELHPWLLCysRP

antiSMASH-DB 4.0 matches for allorf_026894_027097

11.8%

NZ_JAQCXO010000012.1:

Lanthipeptides: allorf_079305_079412_lanthipeptide

39

LSGELHPWLLC

49

L+ E+H WL C

4

LNSEIHKWLSC

14

MIBiG 4.0 matches for allorf_026894_027097

7.8%

BGC0000580.3 (EGD17355.1):

Lasso peptide: xanthomonin II or xanthomonin I

21

ELGGGGVMGV

30

E+GG +G+

8

EMGGITTLGI

17

7.8%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

25

GGVMGVVA

32

G ++G+VA

7

GLILGIVA

14

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.26 out of 23.43

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.54 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.66 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.77 out of 28.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.78 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.57 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.14 out of 31.73

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.37 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.09 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.16 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_013608_013844 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 6797.7 Da

Molecular weight: 6801.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 6819.8 Da N = 1; 6837.8 Da N = 2; 6855.8 Da N = 3; 6873.9 Da N = 4; 6891.9 Da N = 5; 6909.9 Da N = 6

allorf_020464_020658 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 1367.7 Da

Molecular weight: 1368.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1386.5 Da N = 1

allorf_026406_026564 - Class II

Cleavage pHMM score: -2.10

RODEO score: 0

Monoisotopic mass: 3797.9 Da

Molecular weight: 3800.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3818.2 Da N = 1; 3836.2 Da N = 2; 3854.2 Da N = 3; 3872.2 Da N = 4; 3890.2 Da N = 5; 3908.3 Da N = 6

allorf_026894_027097 - Class II

Cleavage pHMM score: -1.10

RODEO score: 0

Monoisotopic mass: 4756.2 Da

Molecular weight: 4759.3 Da

Number of bridges: 1

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator

BAAATP010000024.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 64,249 - 108,631 nt. (total: 44,383 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

GCM10010428_63690: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10010428_63830: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

GCM10010428_64010: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

GCM10010428_64020: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: dehydratase

GCM10010428_63790: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

GCM10010428_63810: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_63850: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.64	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.64	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.58 out of 26.85

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.42 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.34 out of 20.97

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.43 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.47 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.94 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 26.85

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.28 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.54 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.28 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 64248 - 108631:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_63790: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (467..892): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEDAGLVDK
Nearest Stachelhaus code(s):: Orn DTEDMGLVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

GCM10010428_63810: X

AMP-binding (18..418): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GFGCVGINTK
Nearest Stachelhaus code(s):: Val DFFCVGIVHK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000028.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 53,344 nt. (total: 53,344 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

GCM10010428_67650: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

GCM10010428_67670: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

GCM10010428_67740: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10010428_67760: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

GCM10010428_67780: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_67790: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase methyltransferase

GCM10010428_67680: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

GCM10010428_67800: methyltransferase

smcogs: SMCOG1089: methyltransferase

GCM10010428_67810: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase phosphatase

GCM10010428_67660: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

GCM10010428_67730: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: synthase

GCM10010428_67620: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_67630: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000090.4	0.77	PKS	macbecin, macbecin II	Actinosynnema pretiosum subsp. pretiosum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0000068.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000067.5	0.62	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000090.4	0.77	PKS	macbecin, macbecin II	Actinosynnema pretiosum subsp. pretiosum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0000068.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000067.5	0.62	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (17):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.48 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.95 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.00 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.46 out of 29.51

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.80 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.85 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.67 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 11.53 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.56 out of 18.57

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 53344:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - Me-ohmal) + (redmal - Me-ccmal)
Non-colinear ordering:: GCM10010428_67620 + GCM10010428_67630

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_67620: mmal - mmal

PKS_AT (582..874): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.5
Ethylmalonyl-CoA: 189.8
Methoxymalonyl-CoA: 170.1
2-Methylbutyryl-CoA: 129.3
trans-1,2-CPDA: 108.7
Propionyl-CoA: 99.9
CHC-CoA: 96.2
Malonyl-CoA: 95.1
Isobutyryl-CoA: 84.4
Benzoyl-CoA: 61.7
3-Methylbutyryl-CoA: 39.2
Acetyl-CoA: 38.0
fatty_acid: 31.8
inactive: 20.2

PKS_AT (2297..2590): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 194.6
Ethylmalonyl-CoA: 173.5
Methoxymalonyl-CoA: 166.8
Malonyl-CoA: 105.7
2-Methylbutyryl-CoA: 104.9
Propionyl-CoA: 89.3
trans-1,2-CPDA: 88.5
CHC-CoA: 71.7
Isobutyryl-CoA: 69.4
Benzoyl-CoA: 54.3
Acetyl-CoA: 46.6
fatty_acid: 36.9
inactive: 36.4
3-Methylbutyryl-CoA: 35.6

GCM10010428_67630: mal - mmal

PKS_AT (651..946): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.0
inactive: 94.1
Methylmalonyl-CoA: 67.1
Methoxymalonyl-CoA: 66.8
Propionyl-CoA: 29.7
Isobutyryl-CoA: 26.9
Ethylmalonyl-CoA: 22.4
Acetyl-CoA: 21.7
CHC-CoA: 11.6
Benzoyl-CoA: 10.5
2-Methylbutyryl-CoA: 6.1
trans-1,2-CPDA: 4.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: -0.6

PKS_AT (2737..3030): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 199.9
Ethylmalonyl-CoA: 176.6
Methoxymalonyl-CoA: 169.6
Malonyl-CoA: 109.4
2-Methylbutyryl-CoA: 104.1
Propionyl-CoA: 87.4
trans-1,2-CPDA: 87.0
Benzoyl-CoA: 64.4
Isobutyryl-CoA: 60.6
CHC-CoA: 59.7
fatty_acid: 42.6
Acetyl-CoA: 35.4
inactive: 32.5
3-Methylbutyryl-CoA: 24.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000028.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 92,169 - 116,556 nt. (total: 24,388 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

GCM10010428_68270: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

GCM10010428_68290: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

GCM10010428_68320: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase methyltransferase

GCM10010428_68250: methyltransferase

smcogs: SMCOG1089: methyltransferase

GCM10010428_68330: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: synthase

GCM10010428_68340: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.80 out of 23.79

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (9):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.91 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.02 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.61 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.80 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.83 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.51 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 92168 - 116556:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_68340: mal

PKS_AT (658..941): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 159.5
inactive: 70.0
Methoxymalonyl-CoA: 57.1
Methylmalonyl-CoA: 50.2
Propionyl-CoA: 32.5
Ethylmalonyl-CoA: 24.6
2-Methylbutyryl-CoA: 18.7
fatty_acid: 16.0
CHC-CoA: 15.7
Benzoyl-CoA: 9.8
trans-1,2-CPDA: 9.4
Isobutyryl-CoA: 7.1
Acetyl-CoA: 6.2
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000029.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 12,819 nt. (total: 12,819 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

GCM10010428_68420: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Ligases: ligase

GCM10010428_68380: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000572.5	0.36	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0002382.3	0.36	ribosomal	grimoviridin	Grimontia marina
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001407.5	0.36	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000497.3	0.34	ribosomal	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0002442.3	0.34	ribosomal	toyoncin	Bacillus toyonensis
BGC0000569.5	0.32	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.32	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000496.5	0.32	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000572.5	0.36	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0002382.3	0.36	ribosomal	grimoviridin	Grimontia marina
BGC0001229.4	0.36	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001407.5	0.36	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000497.3	0.34	ribosomal	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0002442.3	0.34	ribosomal	toyoncin	Bacillus toyonensis
BGC0000569.5	0.32	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.32	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000496.5	0.32	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

GCM10010428_68360: Lycopene_cycl

Domain 1 (2 - 310): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.48 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

BAAATP010000031.1 - Region 1 - opine-like-metallophore

Download region GenBank file

Download region SVG

Location: 1 - 18,268 nt. (total: 18,268 nt) Show pHMM detection rules used

Region on contig edge.

opine-like-metallophore: (CntL and CntM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002490.2	0.56	other (other)	yersinopine	Yersinia pestis CO92
BGC0002489.2	0.53	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0002488.3	0.53	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.51	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000571.3	0.41	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002322.3	0.41	ribosomal	citrocin	Citrobacter pasteurii
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002490.2	0.56	other (other)	yersinopine	Yersinia pestis CO92
BGC0002489.2	0.53	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0002488.3	0.53	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.51	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000571.3	0.41	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002322.3	0.41	ribosomal	citrocin	Citrobacter pasteurii
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.09 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.54 out of 29.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.49 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000032.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 1 - 9,483 nt. (total: 9,483 nt) Show pHMM detection rules used

Region on contig edge.

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

GCM10010428_71270: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

GCM10010428_71290: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

GCM10010428_71320: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001783.5	0.21	other (other)	streptonigrin	Streptomyces flocculus
BGC0002327.3	0.20	NRPS	bolagladin A, bolagladin B	Burkholderia gladioli
BGC0002336.2	0.19	NRPS	bolagladin A, bolagladin B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001783.5	0.21	other (other)	streptonigrin	Streptomyces flocculus
BGC0002327.3	0.20	NRPS	bolagladin A, bolagladin B	Burkholderia gladioli
BGC0002336.2	0.19	NRPS	bolagladin A, bolagladin B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.41 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.93 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.51 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.65 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

BAAATP010000032.1 - Region 2 - bottromycin

Download region GenBank file

Download region SVG

Location: 21,356 - 42,174 nt. (total: 20,819 nt) Show pHMM detection rules used

bottromycin: botH

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Cyclization oxygenase

GCM10010428_71480: Decarboxylation, Oxidation

MITE: MITE0000044Decarboxylation, Oxidation (identity: 64.70%)
smcogs: SMCOG1007: cytochrome P450

GCM10010428_71520: Cyclization

MITE: MITE0000053Cyclization (identity: 71.10%)

Transferases: Methylation

GCM10010428_71470: Methylation

MITE: MITE0000047Methylation (identity: 69.30%)

GCM10010428_71510: Methylation

MITE: MITE0000046Methylation (identity: 69.20%)

GCM10010428_71550: Methylation

MITE: MITE0000049Methylation (identity: 72.30%)

GCM10010428_71570: Methylation

MITE: MITE0000045Methylation (identity: 63.40%)

Hydrolases: Hydrolysis hydrolase

GCM10010428_71450: Hydrolysis

MITE: MITE0000048Hydrolysis (identity: 61.50%)

GCM10010428_71500: Epimerization

MITE: MITE0000051Epimerization (identity: 62.70%)
smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: oxygenase

GCM10010428_71480: Decarboxylation, Oxidation

MITE: MITE0000044Decarboxylation, Oxidation (identity: 64.70%)
smcogs: SMCOG1007: cytochrome P450

Isomerases: hydrolase

GCM10010428_71500: Epimerization

MITE: MITE0000051Epimerization (identity: 62.70%)
smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000468.5	0.77	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.77	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.75	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.75	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000275.4	0.39	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001377.5	0.39	PKS	uncialamycin	Streptomyces uncialis
BGC0002387.2	0.39	PKS	yangpumicin A	Micromonospora yangpuensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000468.5	0.77	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.77	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.75	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.75	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000275.4	0.39	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001377.5	0.39	PKS	uncialamycin	Streptomyces uncialis
BGC0002387.2	0.39	PKS	yangpumicin A	Micromonospora yangpuensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.89 out of 23.79

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.37 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.52 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.77 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.26 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.09 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.47 out of 30.98

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: Bottromycin_Methyltransferase_RRE; Location: 539 - 614; Score: 97.8; RRE type: Bottromycin_Methyltransferase_RRE; Location: 540 - 615; Score: 79.3; RRE type: Bottromycin_Methyltransferase_RRE; Location: 494 - 570; Score: 105.4

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

BAAATP010000035.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 77,135 nt. (total: 77,135 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

GCM10010428_73610: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

GCM10010428_73780: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10010428_73800: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

GCM10010428_73820: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acyltransferase aminotransferase halogenase

GCM10010428_73620: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

GCM10010428_73740: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

GCM10010428_73810: flavin-dependent cycline orsellinic halogenase

halogenases: flavin-dependent cycline orsellinic halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: hydrolase phosphatase

GCM10010428_73600: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

GCM10010428_73770: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: ligase synthase

GCM10010428_73590: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_73640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_73650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_73670: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

GCM10010428_73680: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10010428_73850: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	1.67	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	1.67	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	1.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	1.56	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.54	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.53	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.50	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	1.50	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	1.42	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.76	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.41 out of 23.43

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.00 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.08 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.26 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.17 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.47 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.38 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.09 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 17.96 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 62033:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-redmal - ccmal) + (Cys) + (Ser - X) + (X - X) + (Me-ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 39586:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-redmal - ccmal) + (Cys) + (Ser - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 4212 - 46156:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-redmal - ccmal) + (Cys) + (Ser - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 6163 - 62033:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-redmal - ccmal) + (Cys) + (Ser - X) + (X - X) + (Me-ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 40706 - 77135:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (Me-ccmal - ccmal) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_73590: AHBA - mmal - mal

CAL_domain (34..434): AHBA

minowa: AHBA

Prediction, score:

AHBA: 509.2
shikimic_acid: 244.0
Acetyl-CoA: 10.0
fatty_acid: 0.0
NH2: -1.4

PKS_AT (1501..1784): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 198.7
Ethylmalonyl-CoA: 178.8
Methoxymalonyl-CoA: 160.9
trans-1,2-CPDA: 121.6
2-Methylbutyryl-CoA: 111.0
Malonyl-CoA: 105.8
Propionyl-CoA: 89.0
CHC-CoA: 86.4
Isobutyryl-CoA: 69.3
Benzoyl-CoA: 55.5
inactive: 47.9
3-Methylbutyryl-CoA: 31.5
Acetyl-CoA: 26.0
fatty_acid: 21.5

PKS_AT (3556..3835): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 143.6
inactive: 52.7
Methoxymalonyl-CoA: 51.8
Methylmalonyl-CoA: 43.5
fatty_acid: 15.2
Ethylmalonyl-CoA: 14.4
Isobutyryl-CoA: 11.7
Benzoyl-CoA: 9.3
Propionyl-CoA: 7.5
2-Methylbutyryl-CoA: 5.6
CHC-CoA: 3.7
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10010428_73640: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (45..439): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

GCM10010428_73650: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (476..875): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHLSLIHK
Nearest Stachelhaus code(s):: Ser DVWHLSLIDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1511..1898): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DARARSLMTK
Nearest Stachelhaus code(s):: Ala DAWHISLMDK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10010428_73680: X - X

AMP-binding (30..432): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPAQVSMINK
Nearest Stachelhaus code(s):: Gly DILQVGMIWK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1080..1476): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DARALSMMTK
Nearest Stachelhaus code(s):: Glu DPRSLSQMAK (56% 8Å match); Dpr DVRHLSMVEK (53% 8Å match); Leu DAFYLGMMCK (50% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10010428_73850: mmal - mal

PKS_AT (557..843): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 185.1
Ethylmalonyl-CoA: 150.5
Methoxymalonyl-CoA: 138.5
2-Methylbutyryl-CoA: 103.3
CHC-CoA: 102.4
trans-1,2-CPDA: 93.9
Propionyl-CoA: 91.3
Malonyl-CoA: 76.1
Isobutyryl-CoA: 55.7
Benzoyl-CoA: 49.1
fatty_acid: 37.1
3-Methylbutyryl-CoA: 32.3
Acetyl-CoA: 28.9
inactive: 14.3

PKS_AT (2270..2545): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 123.5
Methoxymalonyl-CoA: 59.9
Methylmalonyl-CoA: 56.4
inactive: 36.2
Propionyl-CoA: 30.8
Ethylmalonyl-CoA: 19.7
Isobutyryl-CoA: 18.9
fatty_acid: 9.6
Benzoyl-CoA: 5.3
CHC-CoA: 4.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
trans-1,2-CPDA: -0.5
2-Methylbutyryl-CoA: -1.1

GCM10010428_73860: mmal

PKS_AT (559..841): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.4
Ethylmalonyl-CoA: 172.5
Methoxymalonyl-CoA: 153.8
2-Methylbutyryl-CoA: 113.6
trans-1,2-CPDA: 112.4
Malonyl-CoA: 106.7
CHC-CoA: 91.6
Propionyl-CoA: 85.4
Isobutyryl-CoA: 75.9
Benzoyl-CoA: 54.7
inactive: 49.5
3-Methylbutyryl-CoA: 35.5
Acetyl-CoA: 24.7
fatty_acid: 16.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
ToxT	Regulator of MSHA biosynthesis

BAAATP010000036.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 6,080 - 28,543 nt. (total: 22,464 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10010428_73980: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

GCM10010428_74050: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001551.4	0.65	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.64	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001493.5	0.62	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0002074.2	0.60	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0002053.3	0.60	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002064.2	0.59	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001507.3	0.58	ribosomal	anantin C	Streptomyces olindensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001551.4	0.65	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.64	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001493.5	0.62	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0002074.2	0.60	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0002053.3	0.60	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002064.2	0.59	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001507.3	0.58	ribosomal	anantin C	Streptomyces olindensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.80 out of 23.79

Confidence: strong

Additional weak hits (20):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.82 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.59 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.38 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.77 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.46 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.66 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.56 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.75 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.01 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.37 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.17 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.82 out of 30.98

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.29 out of 25.88

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.17 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 82; Score: 69.2; RRE type: Lasso_Fused_RRE; Location: 0 - 51; Score: 28.9

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAATP010000041.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 47,579 nt. (total: 47,579 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

GCM10010428_76720: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10010428_76900: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_76910: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

GCM10010428_76920: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: aminotransferase glycosyltransferase

GCM10010428_76780: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GCM10010428_76890: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: esterase

GCM10010428_76730: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

GCM10010428_76740: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_76760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_76810: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10010428_76830: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10010428_76840: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

Additional weak hits (17):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.03 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.47 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.84 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.29 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.35 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.66 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.37 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.52 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.17 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 32.93

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.68 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 47579:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 42975:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 4342 - 47579:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10010428_76740: mal

PKS_AT (502..786): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 102.9
Methoxymalonyl-CoA: 72.2
Methylmalonyl-CoA: 52.4
Propionyl-CoA: 51.0
inactive: 46.2
2-Methylbutyryl-CoA: 36.4
CHC-CoA: 30.8
Ethylmalonyl-CoA: 25.3
Acetyl-CoA: 23.6
fatty_acid: 21.7
trans-1,2-CPDA: 20.5
Isobutyryl-CoA: 16.7
Benzoyl-CoA: 16.6
3-Methylbutyryl-CoA: 10.4

GCM10010428_76760: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (478..870): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVENVGAVTK
Nearest Stachelhaus code(s):: Arg DVENVGAVTK (62% 8Å match)
Stachelhaus code match:: 100% (strong)

GCM10010428_76830: X

AMP-binding (41..376): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLQSTGTVAK
Nearest Stachelhaus code(s):: Suc ALQSTGTPRK (79% 8Å match)
Stachelhaus code match:: 70% (weak)

GCM10010428_76840: X

AMP-binding (17..414): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFLTQVSK
Nearest Stachelhaus code(s):: Pro DVQFMAQVVK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

BAAATP010000057.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 9,529 nt. (total: 9,529 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

GCM10010428_81200: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.56	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001781.4	0.52	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001550.3	0.49	ribosomal	citrulassin D	Streptomyces katrae
BGC0001634.3	0.48	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000578.3	0.40	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998
BGC0001435.4	0.28	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0000001.5	0.22	PKS	abyssomicin C, atrop-abyssomicin C	Verrucosispora maris AB-18-032
BGC0000119.5	0.20	PKS, saccharide	7-deoxypactamycin	Streptomyces pactum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.56	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001781.4	0.52	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001550.3	0.49	ribosomal	citrulassin D	Streptomyces katrae
BGC0001634.3	0.48	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000578.3	0.40	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998
BGC0001435.4	0.28	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306
BGC0000001.5	0.22	PKS	abyssomicin C, atrop-abyssomicin C	Verrucosispora maris AB-18-032
BGC0000119.5	0.20	PKS, saccharide	7-deoxypactamycin	Streptomyces pactum

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.97 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.20 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.98 out of 39.62

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 82; Score: 42.8

TFBS definitions

Regulator	Description