Kribbella_albertanoniae_JCM_30547 - 29 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

SMKA01000010.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	lanthipeptide-class-iv	66,782	81,426

SMKA01000110.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	redox-cofactor	12,282	25,856	Low	lankacidin C	NRPS:Type I+PKS

SMKA01000117.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	lanthipeptide-class-i	7,257	24,693

SMKA01000012.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	lanthipeptide-class-iv	31,360	54,149

SMKA01000133.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 37.1	terpene	3,300	23,444

SMKA01000013.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 44.1	NRPS,HR-T2PKS	1	69,312	Low	metatricycloene	PKS

SMKA01000146.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 51.1	NI-siderophore	850	22,233

SMKA01000149.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 54.1	lanthipeptide-class-iii	1	19,051	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide

SMKA01000153.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 59.1	lanthipeptide-class-ii	1	21,603

SMKA01000159.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 65.1	terpene-precursor	10,224	21,049

SMKA01000165.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 72.1	NI-siderophore	6,308	20,795

SMKA01000001.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 111.1	lanthipeptide-class-i	20,284	45,621

SMKA01000200.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 112.1	NI-siderophore	1	17,726	Low	peucechelin	NRPS:Type I

SMKA01000207.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 119.1	betalactone,butyrolactone	1	17,460

SMKA01000020.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 122.1	lassopeptide	1	20,715	Low	anantin C	ribosomal:RiPP

SMKA01000217.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 130.1	NAPAA	1	16,564	High	ε-Poly-L-lysine	NRPS:Type I

SMKA01000234.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 149.1	arylpolyene	1	15,388

SMKA01000243.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 159.1	terpene	1	15,146

SMKA01000002.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 222.1	hglE-KS,T1PKS	1	36,995

SMKA01000034.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 277.1	NRPS,T1PKS	5,617	46,097

SMKA01000350.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 278.1	NRPS,T1PKS	1	8,694

SMKA01000035.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 288.1	ectoine	11,139	21,513	Medium	showdomycin	other:other

SMKA01000042.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 366.1	T1PKS,NRPS-like	1	41,718

SMKA01000435.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 372.1	RRE-containing	1	4,205

SMKA01000452.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 391.1	T3PKS	1	3,388	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III

SMKA01000056.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 499.1	lanthipeptide-class-ii	12,715	35,801

SMKA01000088.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 534.1	terpene-precursor	1	20,270

SMKA01000097.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 544.1	NRPS-like	1	27,026

SMKA01000099.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 546.1	aminopolycarboxylic-acid	13,629	26,911	Low	Ethylenediaminesuccinic acid hydroxyarginine	other:other

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	lanthipeptide-class-iv	66,782	81,426
Region 12.1	redox-cofactor	12,282	25,856	Low	lankacidin C	NRPS:Type I+PKS
Region 19.1	lanthipeptide-class-i	7,257	24,693
Region 33.1	lanthipeptide-class-iv	31,360	54,149
Region 37.1	terpene	3,300	23,444
Region 44.1	NRPS,HR-T2PKS	1	69,312	Low	metatricycloene	PKS
Region 51.1	NI-siderophore	850	22,233
Region 54.1	lanthipeptide-class-iii	1	19,051	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide
Region 59.1	lanthipeptide-class-ii	1	21,603
Region 65.1	terpene-precursor	10,224	21,049
Region 72.1	NI-siderophore	6,308	20,795
Region 111.1	lanthipeptide-class-i	20,284	45,621
Region 112.1	NI-siderophore	1	17,726	Low	peucechelin	NRPS:Type I
Region 119.1	betalactone,butyrolactone	1	17,460
Region 122.1	lassopeptide	1	20,715	Low	anantin C	ribosomal:RiPP
Region 130.1	NAPAA	1	16,564	High	ε-Poly-L-lysine	NRPS:Type I
Region 149.1	arylpolyene	1	15,388
Region 159.1	terpene	1	15,146
Region 222.1	hglE-KS,T1PKS	1	36,995
Region 277.1	NRPS,T1PKS	5,617	46,097
Region 278.1	NRPS,T1PKS	1	8,694
Region 288.1	ectoine	11,139	21,513	Medium	showdomycin	other:other
Region 366.1	T1PKS,NRPS-like	1	41,718
Region 372.1	RRE-containing	1	4,205
Region 391.1	T3PKS	1	3,388	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 499.1	lanthipeptide-class-ii	12,715	35,801
Region 534.1	terpene-precursor	1	20,270
Region 544.1	NRPS-like	1	27,026
Region 546.1	aminopolycarboxylic-acid	13,629	26,911	Low	Ethylenediaminesuccinic acid hydroxyarginine	other:other

No secondary metabolite regions were found in these records:: SMKA01000100.1 (Kribbella albertanoniae); SMKA01000101.1 (Kribbella albertanoniae); SMKA01000102.1 (Kribbella albertanoniae); SMKA01000103.1 (Kribbella albertanoniae); SMKA01000104.1 (Kribbella albertanoniae); SMKA01000105.1 (Kribbella albertanoniae); SMKA01000106.1 (Kribbella albertanoniae); SMKA01000107.1 (Kribbella albertanoniae); SMKA01000108.1 (Kribbella albertanoniae); SMKA01000109.1 (Kribbella albertanoniae); SMKA01000111.1 (Kribbella albertanoniae); SMKA01000112.1 (Kribbella albertanoniae); SMKA01000113.1 (Kribbella albertanoniae); SMKA01000114.1 (Kribbella albertanoniae); SMKA01000115.1 (Kribbella albertanoniae); SMKA01000116.1 (Kribbella albertanoniae); SMKA01000118.1 (Kribbella albertanoniae); SMKA01000119.1 (Kribbella albertanoniae); SMKA01000011.1 (Kribbella albertanoniae); SMKA01000120.1 (Kribbella albertanoniae); SMKA01000121.1 (Kribbella albertanoniae); SMKA01000122.1 (Kribbella albertanoniae); SMKA01000123.1 (Kribbella albertanoniae); SMKA01000124.1 (Kribbella albertanoniae); SMKA01000125.1 (Kribbella albertanoniae); SMKA01000126.1 (Kribbella albertanoniae); SMKA01000127.1 (Kribbella albertanoniae); SMKA01000128.1 (Kribbella albertanoniae); SMKA01000129.1 (Kribbella albertanoniae); SMKA01000130.1 (Kribbella albertanoniae); SMKA01000131.1 (Kribbella albertanoniae); SMKA01000132.1 (Kribbella albertanoniae); SMKA01000134.1 (Kribbella albertanoniae); SMKA01000135.1 (Kribbella albertanoniae); SMKA01000136.1 (Kribbella albertanoniae); SMKA01000137.1 (Kribbella albertanoniae); SMKA01000138.1 (Kribbella albertanoniae); SMKA01000139.1 (Kribbella albertanoniae); SMKA01000140.1 (Kribbella albertanoniae); SMKA01000141.1 (Kribbella albertanoniae); SMKA01000142.1 (Kribbella albertanoniae); SMKA01000143.1 (Kribbella albertanoniae); SMKA01000144.1 (Kribbella albertanoniae); SMKA01000145.1 (Kribbella albertanoniae); SMKA01000147.1 (Kribbella albertanoniae); SMKA01000148.1 (Kribbella albertanoniae); SMKA01000014.1 (Kribbella albertanoniae); SMKA01000150.1 (Kribbella albertanoniae); SMKA01000151.1 (Kribbella albertanoniae); SMKA01000152.1 (Kribbella albertanoniae); SMKA01000154.1 (Kribbella albertanoniae); SMKA01000155.1 (Kribbella albertanoniae); SMKA01000156.1 (Kribbella albertanoniae); SMKA01000157.1 (Kribbella albertanoniae); SMKA01000158.1 (Kribbella albertanoniae); SMKA01000015.1 (Kribbella albertanoniae); SMKA01000160.1 (Kribbella albertanoniae); SMKA01000161.1 (Kribbella albertanoniae); SMKA01000162.1 (Kribbella albertanoniae); SMKA01000163.1 (Kribbella albertanoniae); SMKA01000164.1 (Kribbella albertanoniae); SMKA01000166.1 (Kribbella albertanoniae); SMKA01000167.1 (Kribbella albertanoniae); SMKA01000168.1 (Kribbella albertanoniae); SMKA01000169.1 (Kribbella albertanoniae); SMKA01000016.1 (Kribbella albertanoniae); SMKA01000170.1 (Kribbella albertanoniae); SMKA01000171.1 (Kribbella albertanoniae); SMKA01000172.1 (Kribbella albertanoniae); SMKA01000173.1 (Kribbella albertanoniae); SMKA01000174.1 (Kribbella albertanoniae); SMKA01000175.1 (Kribbella albertanoniae); SMKA01000176.1 (Kribbella albertanoniae); SMKA01000177.1 (Kribbella albertanoniae); SMKA01000178.1 (Kribbella albertanoniae); SMKA01000179.1 (Kribbella albertanoniae); SMKA01000017.1 (Kribbella albertanoniae); SMKA01000180.1 (Kribbella albertanoniae); SMKA01000181.1 (Kribbella albertanoniae); SMKA01000182.1 (Kribbella albertanoniae); SMKA01000183.1 (Kribbella albertanoniae); SMKA01000184.1 (Kribbella albertanoniae); SMKA01000185.1 (Kribbella albertanoniae); SMKA01000186.1 (Kribbella albertanoniae); SMKA01000187.1 (Kribbella albertanoniae); SMKA01000188.1 (Kribbella albertanoniae); SMKA01000189.1 (Kribbella albertanoniae); SMKA01000018.1 (Kribbella albertanoniae); SMKA01000190.1 (Kribbella albertanoniae); SMKA01000191.1 (Kribbella albertanoniae); SMKA01000192.1 (Kribbella albertanoniae); SMKA01000193.1 (Kribbella albertanoniae); SMKA01000194.1 (Kribbella albertanoniae); SMKA01000195.1 (Kribbella albertanoniae); SMKA01000196.1 (Kribbella albertanoniae); SMKA01000197.1 (Kribbella albertanoniae); SMKA01000198.1 (Kribbella albertanoniae); SMKA01000199.1 (Kribbella albertanoniae); SMKA01000019.1 (Kribbella albertanoniae); SMKA01000201.1 (Kribbella albertanoniae); SMKA01000202.1 (Kribbella albertanoniae); SMKA01000203.1 (Kribbella albertanoniae); SMKA01000204.1 (Kribbella albertanoniae); SMKA01000205.1 (Kribbella albertanoniae); SMKA01000206.1 (Kribbella albertanoniae); SMKA01000208.1 (Kribbella albertanoniae); SMKA01000209.1 (Kribbella albertanoniae); SMKA01000210.1 (Kribbella albertanoniae); SMKA01000211.1 (Kribbella albertanoniae); SMKA01000212.1 (Kribbella albertanoniae); SMKA01000213.1 (Kribbella albertanoniae); SMKA01000214.1 (Kribbella albertanoniae); SMKA01000215.1 (Kribbella albertanoniae); SMKA01000216.1 (Kribbella albertanoniae); SMKA01000218.1 (Kribbella albertanoniae); SMKA01000219.1 (Kribbella albertanoniae); SMKA01000021.1 (Kribbella albertanoniae); SMKA01000220.1 (Kribbella albertanoniae); SMKA01000221.1 (Kribbella albertanoniae); SMKA01000222.1 (Kribbella albertanoniae); SMKA01000223.1 (Kribbella albertanoniae); SMKA01000224.1 (Kribbella albertanoniae); SMKA01000225.1 (Kribbella albertanoniae); SMKA01000226.1 (Kribbella albertanoniae); SMKA01000227.1 (Kribbella albertanoniae); SMKA01000228.1 (Kribbella albertanoniae); SMKA01000229.1 (Kribbella albertanoniae); SMKA01000022.1 (Kribbella albertanoniae); SMKA01000230.1 (Kribbella albertanoniae); SMKA01000231.1 (Kribbella albertanoniae); SMKA01000232.1 (Kribbella albertanoniae); SMKA01000233.1 (Kribbella albertanoniae); SMKA01000235.1 (Kribbella albertanoniae); SMKA01000236.1 (Kribbella albertanoniae); SMKA01000237.1 (Kribbella albertanoniae); SMKA01000238.1 (Kribbella albertanoniae); SMKA01000239.1 (Kribbella albertanoniae); SMKA01000023.1 (Kribbella albertanoniae); SMKA01000240.1 (Kribbella albertanoniae); SMKA01000241.1 (Kribbella albertanoniae); SMKA01000242.1 (Kribbella albertanoniae); SMKA01000244.1 (Kribbella albertanoniae); SMKA01000245.1 (Kribbella albertanoniae); SMKA01000246.1 (Kribbella albertanoniae); SMKA01000247.1 (Kribbella albertanoniae); SMKA01000248.1 (Kribbella albertanoniae); SMKA01000249.1 (Kribbella albertanoniae); SMKA01000024.1 (Kribbella albertanoniae); SMKA01000250.1 (Kribbella albertanoniae); SMKA01000251.1 (Kribbella albertanoniae); SMKA01000252.1 (Kribbella albertanoniae); SMKA01000253.1 (Kribbella albertanoniae); SMKA01000254.1 (Kribbella albertanoniae); SMKA01000255.1 (Kribbella albertanoniae); SMKA01000256.1 (Kribbella albertanoniae); SMKA01000257.1 (Kribbella albertanoniae); SMKA01000258.1 (Kribbella albertanoniae); SMKA01000259.1 (Kribbella albertanoniae); SMKA01000025.1 (Kribbella albertanoniae); SMKA01000260.1 (Kribbella albertanoniae); SMKA01000261.1 (Kribbella albertanoniae); SMKA01000262.1 (Kribbella albertanoniae); SMKA01000263.1 (Kribbella albertanoniae); SMKA01000264.1 (Kribbella albertanoniae); SMKA01000265.1 (Kribbella albertanoniae); SMKA01000266.1 (Kribbella albertanoniae); SMKA01000267.1 (Kribbella albertanoniae); SMKA01000268.1 (Kribbella albertanoniae); SMKA01000269.1 (Kribbella albertanoniae); SMKA01000026.1 (Kribbella albertanoniae); SMKA01000270.1 (Kribbella albertanoniae); SMKA01000271.1 (Kribbella albertanoniae); SMKA01000272.1 (Kribbella albertanoniae); SMKA01000273.1 (Kribbella albertanoniae); SMKA01000274.1 (Kribbella albertanoniae); SMKA01000275.1 (Kribbella albertanoniae); SMKA01000276.1 (Kribbella albertanoniae); SMKA01000277.1 (Kribbella albertanoniae); SMKA01000278.1 (Kribbella albertanoniae); SMKA01000279.1 (Kribbella albertanoniae); SMKA01000027.1 (Kribbella albertanoniae); SMKA01000280.1 (Kribbella albertanoniae); SMKA01000281.1 (Kribbella albertanoniae); SMKA01000282.1 (Kribbella albertanoniae); SMKA01000283.1 (Kribbella albertanoniae); SMKA01000284.1 (Kribbella albertanoniae); SMKA01000285.1 (Kribbella albertanoniae); SMKA01000286.1 (Kribbella albertanoniae); SMKA01000287.1 (Kribbella albertanoniae); SMKA01000288.1 (Kribbella albertanoniae); SMKA01000289.1 (Kribbella albertanoniae); SMKA01000028.1 (Kribbella albertanoniae); SMKA01000290.1 (Kribbella albertanoniae); SMKA01000291.1 (Kribbella albertanoniae); SMKA01000292.1 (Kribbella albertanoniae); SMKA01000293.1 (Kribbella albertanoniae); SMKA01000294.1 (Kribbella albertanoniae); SMKA01000295.1 (Kribbella albertanoniae); SMKA01000296.1 (Kribbella albertanoniae); SMKA01000297.1 (Kribbella albertanoniae); SMKA01000298.1 (Kribbella albertanoniae); SMKA01000299.1 (Kribbella albertanoniae); SMKA01000029.1 (Kribbella albertanoniae); SMKA01000300.1 (Kribbella albertanoniae); SMKA01000301.1 (Kribbella albertanoniae); SMKA01000302.1 (Kribbella albertanoniae); SMKA01000303.1 (Kribbella albertanoniae); SMKA01000304.1 (Kribbella albertanoniae); SMKA01000305.1 (Kribbella albertanoniae); SMKA01000306.1 (Kribbella albertanoniae); SMKA01000307.1 (Kribbella albertanoniae); SMKA01000308.1 (Kribbella albertanoniae); SMKA01000309.1 (Kribbella albertanoniae); SMKA01000030.1 (Kribbella albertanoniae); SMKA01000310.1 (Kribbella albertanoniae); SMKA01000311.1 (Kribbella albertanoniae); SMKA01000312.1 (Kribbella albertanoniae); SMKA01000313.1 (Kribbella albertanoniae); SMKA01000314.1 (Kribbella albertanoniae); SMKA01000315.1 (Kribbella albertanoniae); SMKA01000316.1 (Kribbella albertanoniae); SMKA01000317.1 (Kribbella albertanoniae); SMKA01000318.1 (Kribbella albertanoniae); SMKA01000319.1 (Kribbella albertanoniae); SMKA01000031.1 (Kribbella albertanoniae); SMKA01000320.1 (Kribbella albertanoniae); SMKA01000321.1 (Kribbella albertanoniae); SMKA01000322.1 (Kribbella albertanoniae); SMKA01000323.1 (Kribbella albertanoniae); SMKA01000324.1 (Kribbella albertanoniae); SMKA01000325.1 (Kribbella albertanoniae); SMKA01000326.1 (Kribbella albertanoniae); SMKA01000327.1 (Kribbella albertanoniae); SMKA01000328.1 (Kribbella albertanoniae); SMKA01000329.1 (Kribbella albertanoniae); SMKA01000032.1 (Kribbella albertanoniae); SMKA01000330.1 (Kribbella albertanoniae); SMKA01000331.1 (Kribbella albertanoniae); SMKA01000332.1 (Kribbella albertanoniae); SMKA01000333.1 (Kribbella albertanoniae); SMKA01000334.1 (Kribbella albertanoniae); SMKA01000335.1 (Kribbella albertanoniae); SMKA01000336.1 (Kribbella albertanoniae); SMKA01000337.1 (Kribbella albertanoniae); SMKA01000338.1 (Kribbella albertanoniae); SMKA01000339.1 (Kribbella albertanoniae); SMKA01000033.1 (Kribbella albertanoniae); SMKA01000340.1 (Kribbella albertanoniae); SMKA01000341.1 (Kribbella albertanoniae); SMKA01000342.1 (Kribbella albertanoniae); SMKA01000343.1 (Kribbella albertanoniae); SMKA01000344.1 (Kribbella albertanoniae); SMKA01000345.1 (Kribbella albertanoniae); SMKA01000346.1 (Kribbella albertanoniae); SMKA01000347.1 (Kribbella albertanoniae); SMKA01000348.1 (Kribbella albertanoniae); SMKA01000349.1 (Kribbella albertanoniae); SMKA01000351.1 (Kribbella albertanoniae); SMKA01000352.1 (Kribbella albertanoniae); SMKA01000353.1 (Kribbella albertanoniae); SMKA01000354.1 (Kribbella albertanoniae); SMKA01000355.1 (Kribbella albertanoniae); SMKA01000356.1 (Kribbella albertanoniae); SMKA01000357.1 (Kribbella albertanoniae); SMKA01000358.1 (Kribbella albertanoniae); SMKA01000359.1 (Kribbella albertanoniae); SMKA01000360.1 (Kribbella albertanoniae); SMKA01000361.1 (Kribbella albertanoniae); SMKA01000362.1 (Kribbella albertanoniae); SMKA01000363.1 (Kribbella albertanoniae); SMKA01000364.1 (Kribbella albertanoniae); SMKA01000365.1 (Kribbella albertanoniae); SMKA01000366.1 (Kribbella albertanoniae); SMKA01000367.1 (Kribbella albertanoniae); SMKA01000368.1 (Kribbella albertanoniae); SMKA01000369.1 (Kribbella albertanoniae); SMKA01000036.1 (Kribbella albertanoniae); SMKA01000370.1 (Kribbella albertanoniae); SMKA01000371.1 (Kribbella albertanoniae); SMKA01000372.1 (Kribbella albertanoniae); SMKA01000373.1 (Kribbella albertanoniae); SMKA01000374.1 (Kribbella albertanoniae); SMKA01000375.1 (Kribbella albertanoniae); SMKA01000376.1 (Kribbella albertanoniae); SMKA01000377.1 (Kribbella albertanoniae); SMKA01000378.1 (Kribbella albertanoniae); SMKA01000379.1 (Kribbella albertanoniae); SMKA01000037.1 (Kribbella albertanoniae); SMKA01000380.1 (Kribbella albertanoniae); SMKA01000381.1 (Kribbella albertanoniae); SMKA01000382.1 (Kribbella albertanoniae); SMKA01000383.1 (Kribbella albertanoniae); SMKA01000384.1 (Kribbella albertanoniae); SMKA01000385.1 (Kribbella albertanoniae); SMKA01000386.1 (Kribbella albertanoniae); SMKA01000387.1 (Kribbella albertanoniae); SMKA01000388.1 (Kribbella albertanoniae); SMKA01000389.1 (Kribbella albertanoniae); SMKA01000038.1 (Kribbella albertanoniae); SMKA01000390.1 (Kribbella albertanoniae); SMKA01000391.1 (Kribbella albertanoniae); SMKA01000392.1 (Kribbella albertanoniae); SMKA01000393.1 (Kribbella albertanoniae); SMKA01000394.1 (Kribbella albertanoniae); SMKA01000395.1 (Kribbella albertanoniae); SMKA01000396.1 (Kribbella albertanoniae); SMKA01000397.1 (Kribbella albertanoniae); SMKA01000398.1 (Kribbella albertanoniae); SMKA01000399.1 (Kribbella albertanoniae); SMKA01000039.1 (Kribbella albertanoniae); SMKA01000003.1 (Kribbella albertanoniae); SMKA01000400.1 (Kribbella albertanoniae); SMKA01000401.1 (Kribbella albertanoniae); SMKA01000402.1 (Kribbella albertanoniae); SMKA01000403.1 (Kribbella albertanoniae); SMKA01000404.1 (Kribbella albertanoniae); SMKA01000405.1 (Kribbella albertanoniae); SMKA01000406.1 (Kribbella albertanoniae); SMKA01000407.1 (Kribbella albertanoniae); SMKA01000408.1 (Kribbella albertanoniae); SMKA01000409.1 (Kribbella albertanoniae); SMKA01000040.1 (Kribbella albertanoniae); SMKA01000410.1 (Kribbella albertanoniae); SMKA01000411.1 (Kribbella albertanoniae); SMKA01000412.1 (Kribbella albertanoniae); SMKA01000413.1 (Kribbella albertanoniae); SMKA01000414.1 (Kribbella albertanoniae); SMKA01000415.1 (Kribbella albertanoniae); SMKA01000416.1 (Kribbella albertanoniae); SMKA01000417.1 (Kribbella albertanoniae); SMKA01000418.1 (Kribbella albertanoniae); SMKA01000419.1 (Kribbella albertanoniae); SMKA01000041.1 (Kribbella albertanoniae); SMKA01000420.1 (Kribbella albertanoniae); SMKA01000421.1 (Kribbella albertanoniae); SMKA01000422.1 (Kribbella albertanoniae); SMKA01000423.1 (Kribbella albertanoniae); SMKA01000424.1 (Kribbella albertanoniae); SMKA01000425.1 (Kribbella albertanoniae); SMKA01000426.1 (Kribbella albertanoniae); SMKA01000427.1 (Kribbella albertanoniae); SMKA01000428.1 (Kribbella albertanoniae); SMKA01000429.1 (Kribbella albertanoniae); SMKA01000430.1 (Kribbella albertanoniae); SMKA01000431.1 (Kribbella albertanoniae); SMKA01000432.1 (Kribbella albertanoniae); SMKA01000433.1 (Kribbella albertanoniae); SMKA01000434.1 (Kribbella albertanoniae); SMKA01000436.1 (Kribbella albertanoniae); SMKA01000437.1 (Kribbella albertanoniae); SMKA01000438.1 (Kribbella albertanoniae); SMKA01000439.1 (Kribbella albertanoniae); SMKA01000043.1 (Kribbella albertanoniae); SMKA01000440.1 (Kribbella albertanoniae); SMKA01000441.1 (Kribbella albertanoniae); SMKA01000442.1 (Kribbella albertanoniae); SMKA01000443.1 (Kribbella albertanoniae); SMKA01000444.1 (Kribbella albertanoniae); SMKA01000445.1 (Kribbella albertanoniae); SMKA01000446.1 (Kribbella albertanoniae); SMKA01000447.1 (Kribbella albertanoniae); SMKA01000448.1 (Kribbella albertanoniae); SMKA01000449.1 (Kribbella albertanoniae); SMKA01000044.1 (Kribbella albertanoniae); SMKA01000450.1 (Kribbella albertanoniae); SMKA01000451.1 (Kribbella albertanoniae); SMKA01000453.1 (Kribbella albertanoniae); SMKA01000454.1 (Kribbella albertanoniae); SMKA01000455.1 (Kribbella albertanoniae); SMKA01000456.1 (Kribbella albertanoniae); SMKA01000457.1 (Kribbella albertanoniae); SMKA01000458.1 (Kribbella albertanoniae); SMKA01000459.1 (Kribbella albertanoniae); SMKA01000045.1 (Kribbella albertanoniae); SMKA01000460.1 (Kribbella albertanoniae); SMKA01000461.1 (Kribbella albertanoniae); SMKA01000462.1 (Kribbella albertanoniae); SMKA01000463.1 (Kribbella albertanoniae); SMKA01000464.1 (Kribbella albertanoniae); SMKA01000465.1 (Kribbella albertanoniae); SMKA01000466.1 (Kribbella albertanoniae); SMKA01000467.1 (Kribbella albertanoniae); SMKA01000468.1 (Kribbella albertanoniae); SMKA01000469.1 (Kribbella albertanoniae); SMKA01000046.1 (Kribbella albertanoniae); SMKA01000470.1 (Kribbella albertanoniae); SMKA01000471.1 (Kribbella albertanoniae); SMKA01000472.1 (Kribbella albertanoniae); SMKA01000473.1 (Kribbella albertanoniae); SMKA01000474.1 (Kribbella albertanoniae); SMKA01000475.1 (Kribbella albertanoniae); SMKA01000476.1 (Kribbella albertanoniae); SMKA01000477.1 (Kribbella albertanoniae); SMKA01000478.1 (Kribbella albertanoniae); SMKA01000479.1 (Kribbella albertanoniae); SMKA01000047.1 (Kribbella albertanoniae); SMKA01000480.1 (Kribbella albertanoniae); SMKA01000481.1 (Kribbella albertanoniae); SMKA01000482.1 (Kribbella albertanoniae); SMKA01000483.1 (Kribbella albertanoniae); SMKA01000484.1 (Kribbella albertanoniae); SMKA01000485.1 (Kribbella albertanoniae); SMKA01000486.1 (Kribbella albertanoniae); SMKA01000487.1 (Kribbella albertanoniae); SMKA01000488.1 (Kribbella albertanoniae); SMKA01000489.1 (Kribbella albertanoniae); SMKA01000048.1 (Kribbella albertanoniae); SMKA01000490.1 (Kribbella albertanoniae); SMKA01000491.1 (Kribbella albertanoniae); SMKA01000492.1 (Kribbella albertanoniae); SMKA01000493.1 (Kribbella albertanoniae); SMKA01000494.1 (Kribbella albertanoniae); SMKA01000495.1 (Kribbella albertanoniae); SMKA01000496.1 (Kribbella albertanoniae); SMKA01000497.1 (Kribbella albertanoniae); SMKA01000498.1 (Kribbella albertanoniae); SMKA01000499.1 (Kribbella albertanoniae); SMKA01000049.1 (Kribbella albertanoniae); SMKA01000004.1 (Kribbella albertanoniae); SMKA01000500.1 (Kribbella albertanoniae); SMKA01000501.1 (Kribbella albertanoniae); SMKA01000502.1 (Kribbella albertanoniae); SMKA01000503.1 (Kribbella albertanoniae); SMKA01000504.1 (Kribbella albertanoniae); SMKA01000505.1 (Kribbella albertanoniae); SMKA01000506.1 (Kribbella albertanoniae); SMKA01000507.1 (Kribbella albertanoniae); SMKA01000508.1 (Kribbella albertanoniae); SMKA01000050.1 (Kribbella albertanoniae); SMKA01000509.1 (Kribbella albertanoniae); SMKA01000510.1 (Kribbella albertanoniae); SMKA01000511.1 (Kribbella albertanoniae); SMKA01000512.1 (Kribbella albertanoniae); SMKA01000513.1 (Kribbella albertanoniae); SMKA01000514.1 (Kribbella albertanoniae); SMKA01000515.1 (Kribbella albertanoniae); SMKA01000516.1 (Kribbella albertanoniae); SMKA01000517.1 (Kribbella albertanoniae); SMKA01000518.1 (Kribbella albertanoniae); SMKA01000051.1 (Kribbella albertanoniae); SMKA01000519.1 (Kribbella albertanoniae); SMKA01000520.1 (Kribbella albertanoniae); SMKA01000521.1 (Kribbella albertanoniae); SMKA01000522.1 (Kribbella albertanoniae); SMKA01000523.1 (Kribbella albertanoniae); SMKA01000524.1 (Kribbella albertanoniae); SMKA01000525.1 (Kribbella albertanoniae); SMKA01000526.1 (Kribbella albertanoniae); SMKA01000527.1 (Kribbella albertanoniae); SMKA01000528.1 (Kribbella albertanoniae); SMKA01000052.1 (Kribbella albertanoniae); SMKA01000529.1 (Kribbella albertanoniae); SMKA01000530.1 (Kribbella albertanoniae); SMKA01000531.1 (Kribbella albertanoniae); SMKA01000532.1 (Kribbella albertanoniae); SMKA01000533.1 (Kribbella albertanoniae); SMKA01000534.1 (Kribbella albertanoniae); SMKA01000535.1 (Kribbella albertanoniae); SMKA01000536.1 (Kribbella albertanoniae); SMKA01000537.1 (Kribbella albertanoniae); SMKA01000053.1 (Kribbella albertanoniae); SMKA01000538.1 (Kribbella albertanoniae); SMKA01000539.1 (Kribbella albertanoniae); SMKA01000540.1 (Kribbella albertanoniae); SMKA01000541.1 (Kribbella albertanoniae); SMKA01000542.1 (Kribbella albertanoniae); SMKA01000543.1 (Kribbella albertanoniae); SMKA01000544.1 (Kribbella albertanoniae); SMKA01000545.1 (Kribbella albertanoniae); SMKA01000546.1 (Kribbella albertanoniae); SMKA01000054.1 (Kribbella albertanoniae); SMKA01000547.1 (Kribbella albertanoniae); SMKA01000055.1 (Kribbella albertanoniae); SMKA01000057.1 (Kribbella albertanoniae); SMKA01000058.1 (Kribbella albertanoniae); SMKA01000059.1 (Kribbella albertanoniae); SMKA01000005.1 (Kribbella albertanoniae); SMKA01000060.1 (Kribbella albertanoniae); SMKA01000061.1 (Kribbella albertanoniae); SMKA01000062.1 (Kribbella albertanoniae); SMKA01000063.1 (Kribbella albertanoniae); SMKA01000064.1 (Kribbella albertanoniae); SMKA01000065.1 (Kribbella albertanoniae); SMKA01000066.1 (Kribbella albertanoniae); SMKA01000067.1 (Kribbella albertanoniae); SMKA01000068.1 (Kribbella albertanoniae); SMKA01000069.1 (Kribbella albertanoniae); SMKA01000006.1 (Kribbella albertanoniae); SMKA01000070.1 (Kribbella albertanoniae); SMKA01000071.1 (Kribbella albertanoniae); SMKA01000072.1 (Kribbella albertanoniae); SMKA01000073.1 (Kribbella albertanoniae); SMKA01000074.1 (Kribbella albertanoniae); SMKA01000075.1 (Kribbella albertanoniae); SMKA01000076.1 (Kribbella albertanoniae); SMKA01000077.1 (Kribbella albertanoniae); SMKA01000078.1 (Kribbella albertanoniae); SMKA01000079.1 (Kribbella albertanoniae); SMKA01000007.1 (Kribbella albertanoniae); SMKA01000080.1 (Kribbella albertanoniae); SMKA01000081.1 (Kribbella albertanoniae); SMKA01000082.1 (Kribbella albertanoniae); SMKA01000083.1 (Kribbella albertanoniae); SMKA01000084.1 (Kribbella albertanoniae); SMKA01000085.1 (Kribbella albertanoniae); SMKA01000086.1 (Kribbella albertanoniae); SMKA01000087.1 (Kribbella albertanoniae); SMKA01000089.1 (Kribbella albertanoniae); SMKA01000008.1 (Kribbella albertanoniae); SMKA01000090.1 (Kribbella albertanoniae); SMKA01000091.1 (Kribbella albertanoniae); SMKA01000092.1 (Kribbella albertanoniae); SMKA01000093.1 (Kribbella albertanoniae); SMKA01000094.1 (Kribbella albertanoniae); SMKA01000095.1 (Kribbella albertanoniae); SMKA01000096.1 (Kribbella albertanoniae); SMKA01000098.1 (Kribbella albertanoniae); SMKA01000009.1 (Kribbella albertanoniae)

Compact view

SMKA01000010.1 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 66,782 - 81,426 nt. (total: 14,645 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

E1261_04900: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.46	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000874.5	0.43	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0001221.5	0.34	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001544.3	0.34	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0002482.2	0.33	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001124.4	0.32	PKS	pyranonigrin E	Aspergillus niger ATCC 1015
BGC0001582.4	0.31	NRPS	ecumicin	Nonomuraea sp. MJM5123
BGC0001080.5	0.31	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0000275.4	0.31	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.46	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000874.5	0.43	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0001221.5	0.34	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001544.3	0.34	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0002482.2	0.33	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001124.4	0.32	PKS	pyranonigrin E	Aspergillus niger ATCC 1015
BGC0001582.4	0.31	NRPS	ecumicin	Nonomuraea sp. MJM5123
BGC0001080.5	0.31	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0000275.4	0.31	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.93 out of 26.85

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

SMKA01000110.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 12,282 - 25,856 nt. (total: 13,575 nt) Show pHMM detection rules used

Region on contig edge.

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000339.5	0.33	NRPS	echinomycin	Streptomyces lasaliensis
BGC0001228.5	0.32	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0000415.5	0.32	NRPS	quinomycin	Streptomyces griseovariabilis subsp. bandungensis
BGC0000450.5	0.31	NRPS	triostin A	Streptomyces triostinicus
BGC0001447.3	0.30	PKS	primycin	Saccharomonospora azurea SZMC 14600
BGC0000434.5	0.30	NRPS	SW-163C, UK-63598, SW-163E, SW-163F, SW-163G	Streptomyces sp. SNA15896
BGC0001637.3	0.29	NRPS	kleboxymycin	Klebsiella oxytoca
BGC0001540.5	0.27	other (other)	CC-1065	Streptomyces zelensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000339.5	0.33	NRPS	echinomycin	Streptomyces lasaliensis
BGC0001228.5	0.32	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0000415.5	0.32	NRPS	quinomycin	Streptomyces griseovariabilis subsp. bandungensis
BGC0000450.5	0.31	NRPS	triostin A	Streptomyces triostinicus
BGC0001447.3	0.30	PKS	primycin	Saccharomonospora azurea SZMC 14600
BGC0000434.5	0.30	NRPS	SW-163C, UK-63598, SW-163E, SW-163F, SW-163G	Streptomyces sp. SNA15896
BGC0001637.3	0.29	NRPS	kleboxymycin	Klebsiella oxytoca
BGC0001540.5	0.27	other (other)	CC-1065	Streptomyces zelensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.41 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 15 - 99; Score: 68.2

TFBS definitions

Regulator	Description

SMKA01000117.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 7,257 - 24,693 nt. (total: 17,437 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

E1261_23505: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

E1261_23510: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000544.4	0.47	ribosomal	planosporicin	Planomonospora alba
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000528.5	0.42	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000515.4	0.42	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000918.3	0.42	other (other)	ochronotic pigment	Streptomyces avermitilis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000544.4	0.47	ribosomal	planosporicin	Planomonospora alba
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000528.5	0.42	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000515.4	0.42	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000918.3	0.42	other (other)	ochronotic pigment	Streptomyces avermitilis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.06 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.73 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 143 - 233; Score: 49.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

SMKA01000012.1 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 31,360 - 54,149 nt. (total: 22,790 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

E1261_05520: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: cyclase

E1261_05515: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Translocases: transport

E1261_05550: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.60	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.59	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.58	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000513.3	0.56	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.55	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.60	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.59	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.58	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000513.3	0.56	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.55	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.98 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.67 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

SMKA01000133.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 3,300 - 23,444 nt. (total: 20,145 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

E1261_25365: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: esterase

E1261_25420: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Lyases: cyclase

E1261_25410: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

E1261_25400: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.58	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.54	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.47	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000639.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000640.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.58	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.54	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.47	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000639.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000640.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

E1261_25400: PT_FPPS_like

Domain 1 (62 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

E1261_25410: T1TS + T1TS

Domain 1 (1 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (330 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.39 out of 23.43

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.60 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description

SMKA01000013.1 - Region 1 - HR-T2PKS,NRPS

Download region GenBank file

Download region SVG

Location: 1 - 69,312 nt. (total: 69,312 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

E1261_05720: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

E1261_05790: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

E1261_05820: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

E1261_05845: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

E1261_05875: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

E1261_05895: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acylase

E1261_05880: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase protease

E1261_05800: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

E1261_05925: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase synthase

E1261_05760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

E1261_05785: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

E1261_05795: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

E1261_05855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.58	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000107.3	0.55	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002276.2	0.54	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001268.4	0.53	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002135.2	0.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.44	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.42	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002510.2	0.42	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001128.4	0.42	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (13):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.82 out of 30.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 36.53

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.01 out of 39.62

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 27.04

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.50 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 69312:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Ser) + (X - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 55426:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Ser) + (X - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 26885 - 69312:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

E1261_05760: X - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (456..832): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDTLISFGDK
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1491..1873): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

E1261_05785: X - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (458..825): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDTLISFGDK
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2244..2662): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DAEDSGLINK
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (82% 8Å match)
Stachelhaus code match:: 70% (weak)

E1261_05795: X

AMP-binding (38..443): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SMPSMGSVVK
Nearest Stachelhaus code(s):: diOH-Bz PMPSGGVVNK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

E1261_05880: mal

PKS_AT (18..306): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 65.6
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 42.1
Propionyl-CoA: 31.1
fatty_acid: 26.6
trans-1,2-CPDA: 19.6
inactive: 18.0
CHC-CoA: 10.8
Ethylmalonyl-CoA: 10.7
2-Methylbutyryl-CoA: 9.2
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

SMKA01000146.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 850 - 22,233 nt. (total: 21,384 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

E1261_26750: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

E1261_26760: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.47	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000548.4	0.45	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000521.3	0.44	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002682.2	0.44	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.43	other (other)	aerobactin	Grimontia hollisae
BGC0001498.5	0.43	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.47	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000548.4	0.45	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000521.3	0.44	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002682.2	0.44	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.43	other (other)	aerobactin	Grimontia hollisae
BGC0001498.5	0.43	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.20 out of 36.53

Confidence: medium

Additional weak hits (2):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.56 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

SMKA01000149.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1 - 19,051 nt. (total: 19,051 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.67	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.51	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.67	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.51	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for E1261_26980

E1261_26985

Leader:

MALLDLQGLETPGYGGGH

Core:

GGGSTLTVLGCASGRPSNLSLLLCH

Core with dehydrations:

GGGDhaDhbLDhbVLGCysADhaGRPDhaNLDhaLLLCysH

antiSMASH-DB 4.0 matches for E1261_26985

88.5%

NZ_CP043661.1and 1 other:

NZ_SOCE01000001.1 Lanthipeptides: EV138_RS20105_lanthipeptide

Lanthipeptides: F1D05_RS17325_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS PSNLSLLLCH

2

GGGSTLTVLGCASHTPSNLSLLLCH

26

88.5%

NZ_SLWN01000005.1:

Lanthipeptides: EV652_RS16625_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGCAS RPSNLSLLLCH

3

GGSTLTVLGCASQRPSNLSLLLCH

26

88.0%

NC_013729.1and 1 other:

NZ_CP114065.1 Lanthipeptides: OX958_RS04450_lanthipeptide

Lanthipeptides: KFLA_RS37165_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGC S RPSNLSLLLCH

2

GGSTLTVLGCGSQRPSNLSLLLCH

25

with 72 more sequence matches

Only the first 10 are displayed here.

88.0%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31650_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS PSNLSL+LCH

1

GGGSTLTVLGCASVTPSNLSLVLCH

25

88.0%

NZ_SHKR01000011.1and 7 others:

NZ_SLWR01000003.1 Lanthipeptides: EV646_RS09945_lanthipeptideNZ_SNWS01000006.1 Lanthipeptides: EV651_RS15130_lanthipeptideNZ_SODF01000002.1 Lanthipeptides: EV650_RS20180_lanthipeptideNZ_SODP01000004.1 Lanthipeptides: EV653_RS35635_lanthipeptideNZ_SODT01000012.1 Lanthipeptides: EV647_RS27100_lanthipeptideNZ_SODU01000003.1 Lanthipeptides: EV137_RS31660_lanthipeptideNZ_SZPZ01000003.1 Lanthipeptides: FDA38_RS24670_lanthipeptide

Lanthipeptides: EV645_RS10765_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGCAS PSNLSLLLCH

2

GGSTLTVLGCASQTPSNLSLLLCH

25

85.2%

NZ_JACHWA010000004.1and 1 other:

NZ_PVZV01000008.1 Lanthipeptides: C2865_RS30430_lanthipeptide

Lanthipeptides: FHS43_RS13815_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS +PSNLSLLLCH

3

GGGSTLTVLGCASAKPSNLSLLLCH

27

84.6%

NC_013595.1and 1 other:

NZ_FOQY01000005.1 Lanthipeptides: BM085_RS08660_lanthipeptide

Lanthipeptides: SROS_RS48825_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGC S +PSNLSLLLCH

2

GGGSTLTVLGCESYKPSNLSLLLCH

26

84.6%

NC_013729.1:

Lanthipeptides: KFLA_RS37060_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGC S +PSNLSLLLCH

2

GGGSTLTVLGCGSAKPSNLSLLLCH

26

84.6%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31645_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS PSNLSL+LCH

2

GGGSTLTVLGCASVTPSNLSLILCH

26

84.6%

NZ_SNWQ01000001.1:

Lanthipeptides: EV643_RS00390_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGC S RPSNLSLLLCH

3

GGSTLTVLGCGSHRPSNLSLLLCH

26

81.5%

NZ_JACDUR010000003.1and 1 other:

NZ_JACDUR010000003.1 Lanthipeptides: HNR30_RS17930_lanthipeptide

Lanthipeptides: HNR30_RS17930_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGC S PSNLSLLLCH

3

GGGSTLTVLGCNSYTPSNLSLLLCH

27

80.8%

NZ_BBYJ01000032.1and 1 other:

NZ_BBYM01000040.1 Lanthipeptides: AWQ70_RS39425_lanthipeptide

Lanthipeptides: AWQ71_RS42200_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVL C SGRPSNLS+ LCH

2

GGGSTLTVLTCQSGRPSNLSIALCH

26

80.0%

NZ_JAIWLT010000005.1and 1 other:

NZ_JAIWLU010000020.1 Lanthipeptides: LDL05_RS29535_lanthipeptide

Lanthipeptides: LDL08_RS14700_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGC SG+PSNLS+ LCH

1

GGSTLTVLGCHSGKPSNLSVALCH

24

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.15 out of 27.55

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.07 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.25 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.75 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

E1261_26985 - Class III

Cleavage pHMM score: 5.70

RODEO score: 0

Monoisotopic mass: 2304.2 Da

Molecular weight: 2305.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2323.7 Da N = 1; 2341.7 Da N = 2; 2359.7 Da N = 3; 2377.7 Da N = 4

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
VqsM	Regulator of quorum-sensing signalling systems

SMKA01000153.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 21,603 nt. (total: 21,603 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

E1261_27345: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

E1261_27360: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

E1261_27365: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Lyases: cyclase

E1261_27370: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.48	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.44	ribosomal	archalan α	Halorussus salinus
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001579.4	0.43	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.43	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.48	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.44	ribosomal	archalan α	Halorussus salinus
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001579.4	0.43	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.43	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description

SMKA01000159.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 10,224 - 21,049 nt. (total: 10,826 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

E1261_28020: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000634.3	0.28	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000643.3	0.28	terpene	carotenoid	Brevundimonas vesicularis
BGC0000648.3	0.28	terpene	carotenoid	Myxococcus xanthus
BGC0000665.5	0.27	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000678.5	0.26	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000636.3	0.25	terpene	carotenoid	Brevibacterium linens
BGC0000666.5	0.25	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001594.3	0.24	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.23	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001595.3	0.23	other (other)	fischerindole	Fischerella sp. SAG 46.79

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000634.3	0.28	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000643.3	0.28	terpene	carotenoid	Brevundimonas vesicularis
BGC0000648.3	0.28	terpene	carotenoid	Myxococcus xanthus
BGC0000665.5	0.27	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000678.5	0.26	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000636.3	0.25	terpene	carotenoid	Brevibacterium linens
BGC0000666.5	0.25	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001594.3	0.24	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.23	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001595.3	0.23	other (other)	fischerindole	Fischerella sp. SAG 46.79

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

E1261_28020: PT_FPPS_like

Domain 1 (47 - 265): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

SMKA01000165.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 6,308 - 20,795 nt. (total: 14,488 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

E1261_28580: sugar transferase

smcogs: SMCOG1146: sugar transferase

Lyases: dehydratase

E1261_28570: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

E1261_28575: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000742.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000769.3	0.47	saccharide	glycopeptidolipid	Mycobacterium avium subsp. hominissuis A5
BGC0000741.3	0.45	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.45	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.45	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000772.5	0.43	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000732.3	0.43	saccharide	capsular polysaccharide	Raoultella planticola
BGC0000733.3	0.42	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000740.3	0.42	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000742.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000769.3	0.47	saccharide	glycopeptidolipid	Mycobacterium avium subsp. hominissuis A5
BGC0000741.3	0.45	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.45	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.45	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000772.5	0.43	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000732.3	0.43	saccharide	capsular polysaccharide	Raoultella planticola
BGC0000733.3	0.42	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000740.3	0.42	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

Additional weak hits (2):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.57 out of 30.98

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

SMKA01000001.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 20,284 - 45,621 nt. (total: 25,338 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

E1261_00095: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

E1261_00100: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.48	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000529.5	0.43	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.48	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000529.5	0.43	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.86 out of 23.79

Confidence: medium

Additional weak hits (3):

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.82 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 159 - 252; Score: 63.9

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

SMKA01000200.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 17,726 nt. (total: 17,726 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

E1261_31850: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: hydrolase

E1261_31855: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: decarboxylase lyase

E1261_31875: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

E1261_31890: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.57	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.52	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002466.3	0.41	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001972.4	0.39	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001735.5	0.35	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000897.5	0.31	other (other)	dehydrophos	Streptomyces luridus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.57	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.52	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002466.3	0.41	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001972.4	0.39	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001735.5	0.35	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000897.5	0.31	other (other)	dehydrophos	Streptomyces luridus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

Additional weak hits (1):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

SMKA01000207.1 - Region 1 - betalactone,butyrolactone

Download region GenBank file

Download region SVG

Location: 1 - 17,460 nt. (total: 17,460 nt) Show pHMM detection rules used

Region on contig edge.

betalactone: (HMGL-like and AMP-binding)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

E1261_32370: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

E1261_32420: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

E1261_32440: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

E1261_32445: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase kinase

E1261_32395: aminotransferase

smcogs: SMCOG1019: aminotransferase

E1261_32415: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Ligases: ligase synthase

E1261_32400: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

E1261_32435: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.93	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.48	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002276.2	0.48	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000850.5	0.42	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001928.2	0.34	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.31	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002496.3	0.25	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000188.5	0.23	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002000.4	0.22	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000509.4	0.22	ribosomal	epilancin 15x	Staphylococcus epidermidis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.50	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001928.2	0.48	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002284.3	0.45	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000895.5	0.44	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0001137.5	0.44	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002334.3	0.43	other (other), ribosomal	heptyltyrazolone, nonyltyrazolone, undecyltyrazolone, (Z)-ω-6-undecenyltyrazolone	Pseudoalteromonas rubra

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.72 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

SMKA01000020.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 20,715 nt. (total: 20,715 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

E1261_07790: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Hydrolases: hydrolase

E1261_07770: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

E1261_07810: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: hydratase

E1261_07715: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

E1261_07725: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Translocases: transport

E1261_07730: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001655.3	0.71	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002053.3	0.71	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0001539.4	0.66	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.64	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002064.2	0.62	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001548.4	0.59	ribosomal	citrulassin A	Streptomyces albulus
BGC0001307.3	0.58	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001655.3	0.71	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002053.3	0.71	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0001539.4	0.66	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.64	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002064.2	0.62	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001548.4	0.59	ribosomal	citrulassin A	Streptomyces albulus
BGC0001307.3	0.58	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (3):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.52 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 83; Score: 74.3

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

SMKA01000217.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 1 - 16,564 nt. (total: 16,564 nt) Show pHMM detection rules used

Region on contig edge.

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

E1261_33230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 16564:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

E1261_33230: X

AMP-binding (20..421): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAESIGTVVK
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

SMKA01000234.1 - Region 1 - arylpolyene

Download region GenBank file

Download region SVG

Location: 1 - 15,388 nt. (total: 15,388 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase methyltransferase

E1261_34465: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

E1261_34485: methyltransferase

smcogs: SMCOG1248: methyltransferase

Ligases: ligase synthase

E1261_34410: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

E1261_34435: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

E1261_34440: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

E1261_34450: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

E1261_34470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000196.4	0.45	PKS	AQ-256, AQ-270a, AQ-284a	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001987.2	0.45	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001736.3	0.44	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002008.3	0.43	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.5	0.43	other (other)	APE Ec	Escherichia coli CFT073

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000196.4	0.45	PKS	AQ-256, AQ-270a, AQ-284a	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001987.2	0.45	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001736.3	0.44	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002008.3	0.43	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.5	0.43	other (other)	APE Ec	Escherichia coli CFT073

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.93 out of 20.97

Confidence: medium

Additional weak hits (2):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.14 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.92 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

E1261_34440: X

AMP-binding (47..428): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALYFT--TK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

E1261_34470: X

AMP-binding (43..377): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VLGLTGMVIK
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

SMKA01000243.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 15,146 nt. (total: 15,146 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

E1261_35135: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Ligases: synthase

E1261_35140: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0001969.3	0.46	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0000798.3	0.42	saccharide	dhurrin	Sorghum bicolor
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001528.4	0.40	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000636.3	0.36	terpene	carotenoid	Brevibacterium linens
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0001969.3	0.46	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0000798.3	0.42	saccharide	dhurrin	Sorghum bicolor
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001528.4	0.40	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000636.3	0.36	terpene	carotenoid	Brevibacterium linens
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

E1261_35125: Lycopene_cycl

Domain 1 (4 - 92): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (2):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production

SMKA01000002.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 1 - 36,995 nt. (total: 36,995 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

E1261_00840: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

E1261_00905: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

E1261_00950: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: glycosyltransferase

E1261_00855: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase hydrolase

E1261_00860: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

E1261_00935: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: synthase

E1261_00870: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

E1261_00875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.58	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.51	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.49	PKS	ACT-Toxin II	Alternaria alternata
BGC0000861.5	0.44	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.44	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000861.5	0.55	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.55	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.71 out of 25.88

Confidence: medium

Additional weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.65 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.55 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.10 out of 20.01

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 36995:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal)
Non-colinear ordering:: E1261_00875 + E1261_00870 + E1261_00865

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

E1261_00870: mal

PKS_AT (618..829): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 4.8
Methylmalonyl-CoA: 4.6
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

E1261_00875: mal

PKS_AT (1202..1497): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 66.4
Methylmalonyl-CoA: 34.2
Methoxymalonyl-CoA: 32.2
inactive: 25.7
Propionyl-CoA: 19.1
2-Methylbutyryl-CoA: 14.8
CHC-CoA: 14.2
fatty_acid: 11.7
Isobutyryl-CoA: 8.3
trans-1,2-CPDA: 7.1
Ethylmalonyl-CoA: 6.3
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Benzoyl-CoA: -0.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
PsrA	Oleic acid responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

SMKA01000034.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 5,617 - 46,097 nt. (total: 40,481 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

E1261_11095: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

E1261_11100: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

E1261_11165: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

E1261_11040: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Ligases: synthase

E1261_11120: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

E1261_11050: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.37 out of 20.97

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.34 out of 21.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.84 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.72 out of 24.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 5616 - 46097:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

E1261_11120: X - mal - X

AMP-binding (43..437): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ALYWVGATAK
Nearest Stachelhaus code(s):: norCMA DPYWWGATFK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

PKS_AT (1134..1403): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.4
Methylmalonyl-CoA: 58.9
Methoxymalonyl-CoA: 58.2
inactive: 39.0
Propionyl-CoA: 36.8
Ethylmalonyl-CoA: 31.7
2-Methylbutyryl-CoA: 26.3
CHC-CoA: 25.7
fatty_acid: 22.5
trans-1,2-CPDA: 21.5
Isobutyryl-CoA: 19.4
Benzoyl-CoA: 15.0
Acetyl-CoA: 9.6
3-Methylbutyryl-CoA: 0.0

AMP-binding (2450..2828): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVHAYAGIIK
Nearest Stachelhaus code(s):: Ala DVWMSAGIIK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

SMKA01000350.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 8,694 nt. (total: 8,694 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

E1261_40940: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.58	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.58	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.57	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.57	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001132.4	0.57	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.57	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.57	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 8694:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

E1261_40940: mal - Pro

Search NORINE for peptide: strict or relaxed

PKS_AT (467..750): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 127.0
inactive: 59.0
Methylmalonyl-CoA: 57.8
Methoxymalonyl-CoA: 46.5
Ethylmalonyl-CoA: 29.9
CHC-CoA: 29.7
Propionyl-CoA: 26.9
Benzoyl-CoA: 26.4
fatty_acid: 22.9
Isobutyryl-CoA: 22.8
2-Methylbutyryl-CoA: 22.3
Acetyl-CoA: 21.1
trans-1,2-CPDA: 17.8
3-Methylbutyryl-CoA: 16.5

AMP-binding (1430..1822): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFVGEIVK
Nearest Stachelhaus code(s):: Trp or Pro DVYFVGGICK (53% 8Å match); Trp DVAVVGEVVK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

SMKA01000035.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 11,139 - 21,513 nt. (total: 10,375 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

E1261_11290: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: ligase

E1261_11275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.64	other (other)	showdomycin	Streptomyces showdoensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.64	other (other)	showdomycin	Streptomyces showdoensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.28 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.18 out of 39.62

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

SMKA01000042.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 41,718 nt. (total: 41,718 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

E1261_12805: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

E1261_12810: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase methyltransferase transferase

E1261_12730: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

E1261_12750: methyltransferase

smcogs: SMCOG1089: methyltransferase

E1261_12790: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

E1261_12820: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: esterase phosphatase

E1261_12780: thioesterase

smcogs: SMCOG1004: thioesterase

E1261_12815: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: dehydratase lyase

E1261_12725: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

E1261_12760: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

E1261_12785: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

E1261_12700: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

E1261_12770: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

E1261_12775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

E1261_12830: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.82	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.66 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.58 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.29 out of 21.55

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 41718:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

E1261_12770: mal

PKS_AT (526..812): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 62.5%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.2
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 52.4
inactive: 49.4
Propionyl-CoA: 39.1
Isobutyryl-CoA: 34.7
2-Methylbutyryl-CoA: 26.1
CHC-CoA: 19.7
Benzoyl-CoA: 16.1
3-Methylbutyryl-CoA: 12.9
Acetyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0

E1261_12775: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (29..424): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DALWVGGTFK
Nearest Stachelhaus code(s):: Val DALWLGGTFK (85% 8Å match); bOH-Val DALWLGGTFK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
ToxT	Regulator of MSHA biosynthesis

SMKA01000435.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 4,205 nt. (total: 4,205 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	RRE-containing	Similarity score	Type	Compound(s)	Organism
BGC0000585.5		0.41	ribosomal	microcin C7	Escherichia coli

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000585.5		0.41	ribosomal	microcin C7	Escherichia coli

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

RREFinder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 93; Score: 53.3

SMKA01000452.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 3,388 nt. (total: 3,388 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

E1261_43910: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase

E1261_43905: Methylation

MITE: MITE0000155Methylation (identity: 66.10%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Ligases: synthase

E1261_43900: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.81	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001905.4	0.51	PKS	violapyrone B	Streptomyces somaliensis
BGC0001077.4	0.48	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002332.2	0.47	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0002362.3	0.42	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001647.3	0.41	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001663.3	0.37	PKS	merocyclophane C, merocyclophane D	Nostoc sp. UIC 10110
BGC0001964.2	0.37	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001357.3	0.34	PKS	carbamidocyclophane A, carbamidocyclophane B, carbamidocyclophane C, carbamidocyclophane D, carbamidocyclophane E, carbamidocyclophane F, carbamidocyclophane H, carbamidocyclophane M, carbamidocyclophane N, carbamidocyclophane O, carbamidocyclophane P, carbamidocyclophane Q, carbamidocyclophane R, carbamidocyclophane S, carbamidocyclophane T, carbamidocyclophane U	Nostoc sp. CAVN2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.81	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001905.4	0.51	PKS	violapyrone B	Streptomyces somaliensis
BGC0001077.4	0.48	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002332.2	0.47	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0002362.3	0.42	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001647.3	0.41	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001663.3	0.37	PKS	merocyclophane C, merocyclophane D	Nostoc sp. UIC 10110
BGC0001964.2	0.37	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001357.3	0.34	PKS	carbamidocyclophane A, carbamidocyclophane B, carbamidocyclophane C, carbamidocyclophane D, carbamidocyclophane E, carbamidocyclophane F, carbamidocyclophane H, carbamidocyclophane M, carbamidocyclophane N, carbamidocyclophane O, carbamidocyclophane P, carbamidocyclophane Q, carbamidocyclophane R, carbamidocyclophane S, carbamidocyclophane T, carbamidocyclophane U	Nostoc sp. CAVN2

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

SMKA01000056.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 12,715 - 35,801 nt. (total: 23,087 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

E1261_15220: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Hydrolases: hydrolase

E1261_15265: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

E1261_15210: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001210.5	0.51	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000528.5	0.50	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.4	0.50	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.49	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000504.5	0.49	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001407.5	0.49	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000554.4	0.49	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.5	0.48	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001210.5	0.51	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000528.5	0.50	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.4	0.50	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.49	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000504.5	0.49	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001407.5	0.49	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000554.4	0.49	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.5	0.48	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for E1261_15210

allorf_19319_19558

Leader:

MAGTLVGEQRHGA

Core:

LSMPSDPAGCHARHGHVTSPQGKTPARPDRRWLRGHQIVDEGPFRQPSKGYFSVGGPPSLQGGRDT

Core with dehydrations:

LDhaMPDhaDPAGCysHARHGHVDhbDhaPQGKDhbPARPDRRWLRGHQIVDEGPFRQPDhaKGYFDhaVGGPPDhaLQGGRDDhb

antiSMASH-DB 4.0 matches for allorf_19319_19558

21.2%

NZ_KN234784.1:

Lanthipeptides: allorf_44132_44347_lanthipeptide

9

GCHARHGHVTS----PQGKTPARPDRRWLRGHQIVDEGPFRQPSKG

50

GC H H T+ P G +P+ ++ + H I E +R P G

4

GCAVDHAHCTARHALPTGSSPSHDAQQGVITHAI-QERRYRGPRSG

48

13.6%

NZ_KB896392.1:

Lanthipeptides: allorf_125391_125627_lanthipeptide

10

CHARHGHVTSPQGKTPARPD

29

C H H G PARPD

1

CRRSHDHAPRTVGHNPARPD

20

10.6%

NZ_NGKX01000001.1:

Lanthipeptides: allorf_2204083_2204274_lanthipeptide

15

GHVTSPQGKTPARPDRRW

32

GH ++ P PD+RW

19

GHNSTSHIPLPWNPDKRW

36

MIBiG 4.0 matches for allorf_19319_19558

9.1%

BGC0000580.3 (EGD17354.1):

Lasso peptide: xanthomonin II or xanthomonin I

42

GPFRQPSKGYFSVGG

56

GP G F+V G

2

GPLAGEEIGGFNVPG

16

allorf_35415_35636

Leader:

MPWCQPDPWWQPVPCRGASPIRGGSPCRAVVPARAVVAARAEPWCQPDPWWQPVPSRGASPIRGA

Core:

SPCRPVVI

Core with dehydrations:

DhaPCysRPVVI

antiSMASH-DB 4.0 matches for allorf_35415_35636

75.0%

NZ_LT630004.1:

Lanthipeptides: allorf_2780927_2781046_lanthipeptide

1

SPCRPVV

7

SPC PVV

1

SPCHPVV

7

17.2%

NZ_LMHM01000017.1:

Lanthipeptides: allorf_240600_240725_lanthipeptide

2

PCRPVV

7

PCRP+V

6

PCRPLV

11

allorf_35667_35798

Leader:

MTCALPSVGMTVPSTLDPVASA

Core:

PVRMSFRGACSRRLACSSSAC

Core with dehydrations:

PVRMDhaFRGACysDhaRRLACysDhaDhaDhaACys

antiSMASH-DB 4.0 matches for allorf_35667_35798

20.0%

NZ_VFNO01000010.1:

Lanthipeptides: allorf_179113_179274_lanthipeptide

10

CSRRLACSSSAC

21

C+ R+ACS+ C

6

CTSRIACSTGDC

17

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.94 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.82 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.69 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_19319_19558 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 6963.5 Da

Molecular weight: 6967.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 6985.7 Da N = 1; 7003.7 Da N = 2; 7021.7 Da N = 3; 7039.7 Da N = 4; 7057.8 Da N = 5; 7075.8 Da N = 6; 7093.8 Da N = 7; 7111.8 Da N = 8

allorf_35415_35636 - Class II

Cleavage pHMM score: -5.30

RODEO score: 0

Monoisotopic mass: 851.5 Da

Molecular weight: 852.1 Da

Number of bridges: 1

allorf_35667_35798 - Class II

Cleavage pHMM score: -7.10

RODEO score: 0

Monoisotopic mass: 2154.0 Da

Molecular weight: 2155.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2173.6 Da N = 1; 2191.6 Da N = 2

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor

SMKA01000088.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 20,270 nt. (total: 20,270 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

E1261_19890: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

E1261_19935: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: phosphorylase

E1261_19930: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Hydrolases: dehalogenase

E1261_19915: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: synthetase

E1261_19910: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.52	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000647.3	0.45	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002402.2	0.44	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000664.5	0.43	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000633.3	0.42	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.42	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.42	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000843.5	0.40	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.52	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000647.3	0.45	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002402.2	0.44	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000664.5	0.43	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000633.3	0.42	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.42	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.42	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000843.5	0.40	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

E1261_19910: PT_FPPS_like

Domain 1 (44 - 347): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.27 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.07 out of 24.78

Confidence: medium

Additional weak hits (3):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.11 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

SMKA01000097.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 27,026 nt. (total: 27,026 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

E1261_21105: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase formyltransferase

E1261_21050: aminotransferase

smcogs: SMCOG1019: aminotransferase

E1261_21090: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.68 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.46 out of 23.43

Confidence: medium

Additional weak hits (6):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.20 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.27 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.30 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.75 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.80 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.27 out of 28.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 27026:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

E1261_21090: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (479..862): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein

SMKA01000099.1 - Region 1 - aminopolycarboxylic-acid

Download region GenBank file

Download region SVG

Location: 13,629 - 26,911 nt. (total: 13,283 nt) Show pHMM detection rules used

Region on contig edge.

aminopolycarboxylic-acid: (AesA and AesB and AesC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

E1261_21340: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: deaminase glucosidase

E1261_21335: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

E1261_21365: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

E1261_21360: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

E1261_21355: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.66	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.56	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.48	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002488.3	0.45	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.45	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0001843.2	0.43	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000894.4	0.43	other (other)	citrinin	Monascus aurantiacus
BGC0002663.2	0.43	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.66	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.56	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.48	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002488.3	0.45	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.45	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0001843.2	0.43	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000894.4	0.43	other (other)	citrinin	Monascus aurantiacus
BGC0002663.2	0.43	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 28.19

Confidence: medium

Additional weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.18 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.70 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.01 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.43 out of 29.38

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor