Micromonospora_aurantiaca_NPDC003500 - 27 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NPDC003500.ctg-0002 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	oligosaccharide,other	1	49,418	Low	cinerubin B	PKS:Type II
Region 2.2	transAT-PKS,NRPS,NRPS-like,PKS-like	99,876	195,114	Medium	Largimycin A1/Largimycin A2/Largimycin A3	NRPS:Type I+PKS:Type I
Region 2.3	betalactone	316,108	338,222
Region 2.4	oligosaccharide,terpene	348,895	387,897
Region 2.5	T2PKS	577,844	650,418	Low	formicamycin A/formicamycin B/formicamycin C/formicamycin D/formicamycin E/formicamycin F/formicamycin G/formicamycin H/formicamycin I/formicamycin J/formicamycin K/formicamycin L/formicamycin M/fasamycin C/fasamycin D/fasamycin E	PKS:Type II aromatic

NPDC003500.ctg-0003 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NAGGN	280,138	294,950
Region 3.2	triceptide	603,115	624,430

NPDC003500.ctg-0005 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	T1PKS	1	156,202	Low	quinolidomicin A	PKS
Region 5.2	T1PKS	160,243	206,092
Region 5.3	NI-siderophore	232,036	261,820	Low	FW0622	other:other
Region 5.4	NRPS-like,NRPS,T1PKS,PKS-like	277,431	345,360
Region 5.5	terpene-precursor	348,392	369,435
Region 5.6	NRPS-like,NRPS,T1PKS	433,235	500,861

NPDC003500.ctg-0006 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	terpene	69,259	91,404	Low	isorenieratene	terpene

NPDC003500.ctg-0007 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	RiPP-like	1	10,363	Low	lymphostin/neolymphostinol B/lymphostinol/neolymphostin B	NRPS:Type I+PKS
Region 7.2	terpene	154,827	175,777
Region 7.3	terpene-precursor	229,132	250,214

NPDC003500.ctg-0009 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	terpene	77,530	98,732

NPDC003500.ctg-0010 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	terpene-precursor	133,591	154,658	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I

NPDC003500.ctg-0011 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	terpene	185,799	206,764

NPDC003500.ctg-0012 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	T3PKS	149,398	190,450	High	loseolamycin A1/loseolamycin A2	PKS

NPDC003500.ctg-0018 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	hydrogen-cyanide	1,649	14,420
Region 18.2	NI-siderophore	32,525	63,736

NPDC003500.ctg-0020 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	T1PKS,NRPS-like,2dos,NRPS	1	59,350	Low	quinolidomicin A	PKS

NPDC003500.ctg-0021 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	terpene	44,194	58,693	Low	frankiamicin	PKS

NPDC003500.ctg-0023 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	T2PKS	1	31,471	Low	komodoquinone B	PKS:Type II aromatic

NPDC003500.ctg-0025 (Micromonospora aurantiaca)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	lanthipeptide-class-i	5,043	22,550

No secondary metabolite regions were found in these records:: NPDC003500.ctg-0001 (Micromonospora aurantiaca); NPDC003500.ctg-0004 (Micromonospora aurantiaca); NPDC003500.ctg-0008 (Micromonospora aurantiaca); NPDC003500.ctg-0013 (Micromonospora aurantiaca); NPDC003500.ctg-0014 (Micromonospora aurantiaca); NPDC003500.ctg-0015 (Micromonospora aurantiaca); NPDC003500.ctg-0016 (Micromonospora aurantiaca); NPDC003500.ctg-0017 (Micromonospora aurantiaca); NPDC003500.ctg-0019 (Micromonospora aurantiaca); NPDC003500.ctg-0022 (Micromonospora aurantiaca); NPDC003500.ctg-0024 (Micromonospora aurantiaca); NPDC003500.ctg-0026 (Micromonospora aurantiaca); NPDC003500.ctg-0027 (Micromonospora aurantiaca); NPDC003500.ctg-0028 (Micromonospora aurantiaca); NPDC003500.ctg-0029 (Micromonospora aurantiaca); NPDC003500.ctg-0030 (Micromonospora aurantiaca); NPDC003500.ctg-0031 (Micromonospora aurantiaca); NPDC003500.ctg-0032 (Micromonospora aurantiaca); NPDC003500.ctg-0033 (Micromonospora aurantiaca); NPDC003500.ctg-0034 (Micromonospora aurantiaca); NPDC003500.ctg-0035 (Micromonospora aurantiaca); NPDC003500.ctg-0036 (Micromonospora aurantiaca); NPDC003500.ctg-0037 (Micromonospora aurantiaca); NPDC003500.ctg-0038 (Micromonospora aurantiaca); NPDC003500.ctg-0039 (Micromonospora aurantiaca); NPDC003500.ctg-0040 (Micromonospora aurantiaca); NPDC003500.ctg-0041 (Micromonospora aurantiaca); NPDC003500.ctg-0042 (Micromonospora aurantiaca); NPDC003500.ctg-0043 (Micromonospora aurantiaca); NPDC003500.ctg-0044 (Micromonospora aurantiaca); NPDC003500.ctg-0045 (Micromonospora aurantiaca); NPDC003500.ctg-0046 (Micromonospora aurantiaca); NPDC003500.ctg-0047 (Micromonospora aurantiaca); NPDC003500.ctg-0048 (Micromonospora aurantiaca); NPDC003500.ctg-0049 (Micromonospora aurantiaca)

Compact view

NPDC003500.ctg-0002 - Region 1 - oligosaccharide,other

Download region GenBank file

Download region SVG

Location: 1 - 49,418 nt. (total: 49,418 nt) Show pHMM detection rules used

Region on contig edge.

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

CDS_00902: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_00909: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_00913: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

CDS_00919: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

CDS_00928: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase glycosyltransferase methyltransferase

CDS_00901: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CDS_00905: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CDS_00908: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CDS_00911: methyltransferase

smcogs: SMCOG1089: methyltransferase

CDS_00920: methyltransferase

smcogs: SMCOG1248: methyltransferase

CDS_00921: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CDS_00923: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CDS_00925: methyltransferase

smcogs: SMCOG1248: methyltransferase

CDS_00927: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: dehydratase

CDS_00903: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000278.3	0.49	PKS	urdamycin	Streptomyces fradiae
BGC0000207.5	0.42	PKS	chartreusin	Streptomyces chartreusis
BGC0001817.5	0.40	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000277.5	0.38	PKS	urdamycin	Streptomyces fradiae
BGC0000898.5	0.32	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000826.5	0.31	other (other)	staurosporine	Streptomyces clavuligerus ATCC 27064
BGC0000825.5	0.30	other (other)	staurosporine	Streptomyces sp. TP-A0274
BGC0001387.5	0.29	other (other)	nucleocidin	Streptomyces calvus
BGC0000899.4	0.29	saccharide	desosamine	Streptomyces narbonensis
BGC0000587.5	0.29	ribosomal	microcin H47	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000278.3	0.59	PKS	urdamycin	Streptomyces fradiae
BGC0001817.5	0.56	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000207.5	0.54	PKS	chartreusin	Streptomyces chartreusis
BGC0000277.5	0.53	PKS	urdamycin	Streptomyces fradiae
BGC0000898.5	0.49	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000826.5	0.48	other (other)	staurosporine	Streptomyces clavuligerus ATCC 27064
BGC0000825.5	0.47	other (other)	staurosporine	Streptomyces sp. TP-A0274
BGC0000193.3	0.47	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000584.5	0.47	ribosomal	colicin V	Escherichia coli
BGC0002260.3	0.46	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.08 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.79 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.17 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.31 out of 21.55

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.78 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.55 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.32 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.07 out of 30.98

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0002 - Region 2 - NRPS,NRPS-like,PKS-like,transAT-PKS

Download region GenBank file

Download region SVG

Location: 99,876 - 195,114 nt. (total: 95,239 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CDS_00998: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_01011: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_01020: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_01040: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acylase aminotransferase halogenase methyltransferase

CDS_01007: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_01021: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

CDS_01024: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_01030: halogenase

smcogs: SMCOG1119: halogenase

CDS_01037: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: esterase

CDS_01022: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: hydratase

CDS_01008: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

CDS_01002: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_01003: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

CDS_01014: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

CDS_01023: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_01026: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_01029: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

CDS_00988: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	1.28	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.28	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	1.27	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	1.25	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.25	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.24	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.24	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.23	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	1.22	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	1.22	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (15):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.45 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.48 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.02 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.40 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.03 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.76 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.75 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.30 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 99875 - 195114:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (mal - Me-ccmal - ohmal - mal) + (Cys) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 99875 - 189829:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (mal - Me-ccmal - ohmal - mal) + (Cys) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 150819 - 192685:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 153875 - 195114:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_01002: X

AMP-binding (20..399): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: PLTIGAAPAK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CDS_01007: mal

PKS_AT (7..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 58.3%; 2-Methylbutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.2
inactive: 48.9
Methylmalonyl-CoA: 41.7
Methoxymalonyl-CoA: 39.7
Propionyl-CoA: 27.4
2-Methylbutyryl-CoA: 10.5
CHC-CoA: 9.8
fatty_acid: 7.2
Benzoyl-CoA: 7.2
Ethylmalonyl-CoA: 6.9
trans-1,2-CPDA: 6.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Isobutyryl-CoA: -0.4

CDS_01023: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (919..1322): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNFSLVWK
Nearest Stachelhaus code(s):: Cys DLFNFSLVWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

CDS_01024: mal

PKS_AT (27..303): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.2
Methoxymalonyl-CoA: 41.3
Methylmalonyl-CoA: 32.6
inactive: 30.5
Propionyl-CoA: 26.4
2-Methylbutyryl-CoA: 18.5
Isobutyryl-CoA: 13.7
fatty_acid: 9.8
Benzoyl-CoA: 7.6
CHC-CoA: 5.1
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CDS_01026: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (10..435): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0002 - Region 3 - betalactone

Download region GenBank file

Download region SVG

Location: 316,108 - 338,222 nt. (total: 22,115 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_01124: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CDS_01127: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_01128: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

CDS_01133: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

CDS_01129: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: dehydratase hydratase

CDS_01123: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

CDS_01132: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

CDS_01139: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

CDS_01130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_01131: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000706.3	0.45	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000218.5	0.43	PKS	doxorubicin	Streptomyces peucetius
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000252.5	0.41	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0000207.5	0.41	PKS	chartreusin	Streptomyces chartreusis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000706.3	0.45	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000218.5	0.43	PKS	doxorubicin	Streptomyces peucetius
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000252.5	0.41	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0000207.5	0.41	PKS	chartreusin	Streptomyces chartreusis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.52 out of 23.79

Confidence: medium

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.95 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0002 - Region 4 - oligosaccharide,terpene

Download region GenBank file

Download region SVG

Location: 348,895 - 387,897 nt. (total: 39,003 nt) Show pHMM detection rules used

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CDS_01161: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_01168: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_01170: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_01171: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

CDS_01176: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: PPTase aminotransferase glycosyltransferase methyltransferase

CDS_01166: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CDS_01169: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CDS_01172: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CDS_01177: aminotransferase

smcogs: SMCOG1019: aminotransferase

CDS_01180: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: ligase synthase synthetase

CDS_01163: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_01167: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_01173: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

CDS_01179: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CDS_01183: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.42	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000844.5	0.38	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001310.5	0.37	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001529.5	0.35	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001485.4	0.35	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002347.3	0.34	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001605.3	0.34	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002127.3	0.33	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001075.5	0.32	PKS, terpene	aurachin RE	Rhodococcus erythropolis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002007.2	0.55	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001201.3	0.52	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001485.4	0.50	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001529.5	0.50	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002347.3	0.49	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001605.3	0.49	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CDS_01173: PT_FPPS_like

Domain 1 (40 - 330): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

CDS_01175: T2TS

Domain 1 (311 - 549): Type 2 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (13):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.14 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.29 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.76 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.83 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.03 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.62 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.69 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.31 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0002 - Region 5 - T2PKS

Download region GenBank file

Download region SVG

Location: 577,844 - 650,418 nt. (total: 72,575 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

CDS_01376: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

CDS_01410: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acyltransferase aminotransferase carboxylase transferase

CDS_01383: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

CDS_01385: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

CDS_01413: aminotransferase

smcogs: SMCOG1019: aminotransferase

CDS_01420: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase protease

CDS_01405: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

CDS_01411: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

CDS_01417: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

CDS_01380: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

CDS_01382: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

CDS_01386: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: mutase

CDS_01419: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

CDS_01369: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_01388: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_01389: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_01391: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_01396: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_01402: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

CDS_01408: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.62	PKS	spore pigment	Streptomyces avermitilis
BGC0000275.4	0.61	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000261.5	0.58	PKS	R1128	Streptomyces sp. R1128
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.62	PKS	spore pigment	Streptomyces avermitilis
BGC0000275.4	0.61	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000261.5	0.58	PKS	R1128	Streptomyces sp. R1128
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.01 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (11):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.82 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.89 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.88 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.08 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.55 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

CDS_01369: X

AMP-binding (87..338): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLGMVGIVEK
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

CDS_01391: X

AMP-binding (35..359): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLGVTGMVIK
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

CDS_01396: X

AMP-binding (48..431): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALFFT--VK
Nearest Stachelhaus code(s):: Trp GALFFAAGVK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

CDS_01408: X

AMP-binding (17..408): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -LGFNGVVIK
Nearest Stachelhaus code(s):: Hph or Hty DLGFTGCVNK (38% 8Å match); Hty DLGFTGCVTK (35% 8Å match); 3Me-Glu or Glu DLGKTGVVNK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 577843 to 650418
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

CDS_01380: CYC C4-C21/C2-C23|C2-C19 (Score: 111.0; E-value: 5.8e-35)
CDS_01382: CYC C4-C21/C2-C23|C2-C19 (Score: 130.9; E-value: 4e-41)
CDS_01386: CYC C9-C14 (Score: 239.5; E-value: 2.5e-74)
CDS_01387: CYC C5-C18 (Score: 211.9; E-value: 5.7e-66)
CDS_01388: KS (Score: 708.4; E-value: 6.5e-216)
CDS_01389: CLF (Score: 497.8; E-value: 5.1e-152)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CelR	Cellobiose uptake repressor

NPDC003500.ctg-0003 - Region 1 - NAGGN

Download region GenBank file

Download region SVG

Location: 280,138 - 294,950 nt. (total: 14,813 nt) Show pHMM detection rules used

NAGGN: ((TIGR03104 or cds(GATase_7 and Asn_synthase)) and TIGR03103 and (TIGR03106 or Peptidase_M42))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfhydrylase

CDS_01803: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: hydrolase

CDS_01797: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: synthase

CDS_01792: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.44	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001587.5	0.38	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001374.5	0.36	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000815.4	0.34	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000943.5	0.34	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002568.2	0.34	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.44	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001587.5	0.38	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001374.5	0.36	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000815.4	0.34	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000943.5	0.34	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002568.2	0.34	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.24 out of 23.43

Confidence: medium

Additional weak hits (2):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 27.04

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0003 - Region 2 - triceptide

Download region GenBank file

Download region SVG

Location: 603,115 - 624,430 nt. (total: 21,316 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002448.2	0.25	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000907.5	0.22	other (other)	lincomycin	Streptomyces lincolnensis
BGC0000203.3	0.22	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0000288.5	0.20	NRPS	A-503083 A, A-503083 B, A-503083 E, A-503083 F	Streptomyces sp. SANK 62799

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002448.2	0.25	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000907.5	0.22	other (other)	lincomycin	Streptomyces lincolnensis
BGC0000203.3	0.22	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0000288.5	0.20	NRPS	A-503083 A, A-503083 B, A-503083 E, A-503083 F	Streptomyces sp. SANK 62799

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

Additional weak hits (2):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NPDC003500.ctg-0005 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 156,202 nt. (total: 156,202 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase acylase

CDS_02690: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_02701: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

CDS_02703: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

CDS_02685: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_02686: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_02687: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_02688: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_02689: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_02691: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_02692: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_02693: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_02694: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_02699: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_02702: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002520.2	0.72	PKS	quinolidomicin A	Micromonospora sp.
BGC0000018.5	0.69	PKS	angolamycin	Streptomyces eurythermus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002520.2	0.72	PKS	quinolidomicin A	Micromonospora sp.
BGC0000018.5	0.69	PKS	angolamycin	Streptomyces eurythermus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

Additional weak hits (22):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.56 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.49 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.32 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.33 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.75 out of 36.54

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.53 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.96 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.98 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.86 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.79 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.24 out of 32.74

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.75 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.04 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.81 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 156202:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (redmal - pk - ccmal - ohmal) + (ohmal - ccmal - ccmal - ccmal - ohmal - ohmal) + (ohmal) + (ccmal - ohmal) + (ohmal - Me-redmal) + (ohmal - Me-ohmal - Me-ohmal) + (ccmal - Me-ccmal) + (Me-ohmal) + (Me-ohmal - ohmal) + (ohmal)
Non-colinear ordering:: CDS_02685 + CDS_02686 + CDS_02687 + CDS_02688 + CDS_02689 + CDS_02690 + CDS_02691 + CDS_02692 + CDS_02693 + CDS_02694

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_02685: mal - pk - mal - mal

PKS_AT (567..856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.6
inactive: 111.1
Methoxymalonyl-CoA: 71.1
Methylmalonyl-CoA: 62.0
Propionyl-CoA: 38.5
Isobutyryl-CoA: 34.1
Ethylmalonyl-CoA: 33.0
2-Methylbutyryl-CoA: 25.0
Benzoyl-CoA: 21.7
Acetyl-CoA: 21.3
trans-1,2-CPDA: 10.4
fatty_acid: 9.7
CHC-CoA: 9.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (2635..2932): pk

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 199.8
Methylmalonyl-CoA: 195.8
Methoxymalonyl-CoA: 159.1
2-Methylbutyryl-CoA: 140.6
trans-1,2-CPDA: 115.4
Propionyl-CoA: 112.5
CHC-CoA: 109.7
Isobutyryl-CoA: 97.0
Malonyl-CoA: 95.7
Benzoyl-CoA: 69.8
Acetyl-CoA: 49.0
3-Methylbutyryl-CoA: 36.3
fatty_acid: 24.7
inactive: 23.7

PKS_AT (4704..5003): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.9
inactive: 109.6
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 62.4
Propionyl-CoA: 43.5
Isobutyryl-CoA: 32.0
Ethylmalonyl-CoA: 31.1
2-Methylbutyryl-CoA: 26.6
Acetyl-CoA: 20.8
Benzoyl-CoA: 19.0
fatty_acid: 11.5
CHC-CoA: 9.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (6453..6748): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.1
inactive: 113.3
Methoxymalonyl-CoA: 68.9
Methylmalonyl-CoA: 60.3
Propionyl-CoA: 41.1
Isobutyryl-CoA: 29.2
Acetyl-CoA: 28.0
Ethylmalonyl-CoA: 24.0
Benzoyl-CoA: 20.1
2-Methylbutyryl-CoA: 12.9
fatty_acid: 11.2
CHC-CoA: 9.2
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CDS_02686: mal - mal - mal - mal - mal - mal

PKS_AT (572..877): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.1
inactive: 107.6
Methoxymalonyl-CoA: 62.4
Methylmalonyl-CoA: 51.7
Propionyl-CoA: 36.9
Isobutyryl-CoA: 25.3
Acetyl-CoA: 22.6
2-Methylbutyryl-CoA: 20.8
Ethylmalonyl-CoA: 20.6
Benzoyl-CoA: 13.3
CHC-CoA: 9.9
fatty_acid: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2133..2431): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.3
inactive: 107.5
Methoxymalonyl-CoA: 65.4
Methylmalonyl-CoA: 57.0
Propionyl-CoA: 36.0
Isobutyryl-CoA: 33.3
Ethylmalonyl-CoA: 23.8
Acetyl-CoA: 20.8
Benzoyl-CoA: 15.1
fatty_acid: 9.1
2-Methylbutyryl-CoA: 8.7
CHC-CoA: 5.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3884..4180): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.2
inactive: 102.0
Methoxymalonyl-CoA: 61.6
Methylmalonyl-CoA: 55.4
Propionyl-CoA: 30.1
Isobutyryl-CoA: 25.4
Ethylmalonyl-CoA: 24.2
Acetyl-CoA: 16.5
Benzoyl-CoA: 13.5
2-Methylbutyryl-CoA: 13.3
fatty_acid: 10.8
CHC-CoA: 8.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5627..5925): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.1
inactive: 106.4
Methoxymalonyl-CoA: 62.4
Methylmalonyl-CoA: 54.4
Propionyl-CoA: 28.9
Isobutyryl-CoA: 26.3
Acetyl-CoA: 20.7
Ethylmalonyl-CoA: 19.7
2-Methylbutyryl-CoA: 15.2
Benzoyl-CoA: 14.4
fatty_acid: 12.1
CHC-CoA: 7.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (7371..7669): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.6
inactive: 113.7
Methoxymalonyl-CoA: 68.5
Methylmalonyl-CoA: 60.2
Isobutyryl-CoA: 40.0
Propionyl-CoA: 33.7
Ethylmalonyl-CoA: 30.1
Acetyl-CoA: 23.3
2-Methylbutyryl-CoA: 22.7
Benzoyl-CoA: 22.5
fatty_acid: 13.8
CHC-CoA: 13.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8895..9193): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.5
inactive: 107.6
Methoxymalonyl-CoA: 66.4
Methylmalonyl-CoA: 57.7
Propionyl-CoA: 39.3
Isobutyryl-CoA: 21.6
Benzoyl-CoA: 21.5
2-Methylbutyryl-CoA: 17.8
Acetyl-CoA: 16.6
fatty_acid: 12.5
trans-1,2-CPDA: 11.9
CHC-CoA: 10.3
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -2.5

CDS_02687: mal

PKS_AT (583..882): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.3
inactive: 108.2
Methoxymalonyl-CoA: 65.6
Methylmalonyl-CoA: 46.6
Propionyl-CoA: 38.9
Ethylmalonyl-CoA: 20.7
Acetyl-CoA: 20.6
Isobutyryl-CoA: 18.4
2-Methylbutyryl-CoA: 14.8
trans-1,2-CPDA: 14.3
Benzoyl-CoA: 12.9
CHC-CoA: 9.5
fatty_acid: 8.4
3-Methylbutyryl-CoA: 0.0

CDS_02688: mal - mal

PKS_AT (571..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.8
inactive: 110.1
Methoxymalonyl-CoA: 66.9
Methylmalonyl-CoA: 61.0
Ethylmalonyl-CoA: 33.5
Propionyl-CoA: 29.8
Isobutyryl-CoA: 23.6
Benzoyl-CoA: 19.2
Acetyl-CoA: 14.6
fatty_acid: 14.4
CHC-CoA: 14.1
2-Methylbutyryl-CoA: 9.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3802..4091): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.1
inactive: 100.8
Methoxymalonyl-CoA: 57.3
Methylmalonyl-CoA: 46.0
Propionyl-CoA: 20.6
Benzoyl-CoA: 18.1
fatty_acid: 14.3
Acetyl-CoA: 12.5
Isobutyryl-CoA: 10.1
Ethylmalonyl-CoA: 8.2
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CDS_02689: mal - mmal

PKS_AT (563..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.4
inactive: 115.2
Methoxymalonyl-CoA: 60.1
Methylmalonyl-CoA: 51.0
Isobutyryl-CoA: 29.8
Propionyl-CoA: 22.0
fatty_acid: 17.4
Acetyl-CoA: 15.5
Ethylmalonyl-CoA: 11.3
Benzoyl-CoA: 9.8
2-Methylbutyryl-CoA: 7.1
CHC-CoA: 2.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2131..2426): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 168.6
Methoxymalonyl-CoA: 143.8
Ethylmalonyl-CoA: 142.0
2-Methylbutyryl-CoA: 117.4
Propionyl-CoA: 114.7
Malonyl-CoA: 99.0
trans-1,2-CPDA: 94.7
CHC-CoA: 71.1
Isobutyryl-CoA: 49.5
Acetyl-CoA: 35.4
fatty_acid: 35.0
Benzoyl-CoA: 34.9
inactive: 32.6
3-Methylbutyryl-CoA: 31.2

CDS_02690: mal - mmal - mmal

PKS_AT (569..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.8
inactive: 109.9
Methoxymalonyl-CoA: 61.5
Methylmalonyl-CoA: 50.5
Propionyl-CoA: 27.9
Isobutyryl-CoA: 25.3
Acetyl-CoA: 19.5
Ethylmalonyl-CoA: 18.2
Benzoyl-CoA: 13.1
2-Methylbutyryl-CoA: 11.0
fatty_acid: 8.7
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2075..2375): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.0
Ethylmalonyl-CoA: 199.1
Methoxymalonyl-CoA: 171.3
2-Methylbutyryl-CoA: 122.6
trans-1,2-CPDA: 113.6
Propionyl-CoA: 100.5
Malonyl-CoA: 93.8
Isobutyryl-CoA: 78.6
CHC-CoA: 76.9
Benzoyl-CoA: 70.7
3-Methylbutyryl-CoA: 50.3
Acetyl-CoA: 45.6
fatty_acid: 34.2
inactive: 33.6

PKS_AT (3637..3932): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 172.4
Methoxymalonyl-CoA: 147.1
Ethylmalonyl-CoA: 146.5
2-Methylbutyryl-CoA: 127.3
Propionyl-CoA: 118.8
Malonyl-CoA: 102.3
trans-1,2-CPDA: 92.4
CHC-CoA: 72.3
Isobutyryl-CoA: 60.1
Acetyl-CoA: 41.2
3-Methylbutyryl-CoA: 36.0
fatty_acid: 34.7
inactive: 33.6
Benzoyl-CoA: 25.8

CDS_02691: mal - mmal

PKS_AT (567..863): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.8
inactive: 107.1
Methoxymalonyl-CoA: 68.5
Methylmalonyl-CoA: 57.9
Propionyl-CoA: 32.3
Isobutyryl-CoA: 27.8
Benzoyl-CoA: 27.5
Ethylmalonyl-CoA: 24.3
Acetyl-CoA: 19.7
2-Methylbutyryl-CoA: 17.3
fatty_acid: 8.7
trans-1,2-CPDA: 5.2
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2346..2641): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 168.8
Ethylmalonyl-CoA: 143.9
Methoxymalonyl-CoA: 143.5
2-Methylbutyryl-CoA: 118.1
Propionyl-CoA: 114.0
Malonyl-CoA: 100.9
trans-1,2-CPDA: 92.0
CHC-CoA: 69.6
Isobutyryl-CoA: 49.2
Acetyl-CoA: 34.0
fatty_acid: 33.1
inactive: 31.0
3-Methylbutyryl-CoA: 30.6
Benzoyl-CoA: 23.7

CDS_02692: mmal

PKS_AT (583..878): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 174.9
Ethylmalonyl-CoA: 146.2
Methoxymalonyl-CoA: 144.5
2-Methylbutyryl-CoA: 124.5
Propionyl-CoA: 118.3
Malonyl-CoA: 108.1
trans-1,2-CPDA: 101.9
CHC-CoA: 71.6
Isobutyryl-CoA: 66.9
Acetyl-CoA: 50.8
3-Methylbutyryl-CoA: 39.2
Benzoyl-CoA: 38.5
fatty_acid: 35.4
inactive: 28.7

CDS_02693: mmal - mal

PKS_AT (572..867): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 167.8
Ethylmalonyl-CoA: 138.5
Methoxymalonyl-CoA: 137.8
Propionyl-CoA: 113.6
2-Methylbutyryl-CoA: 111.8
Malonyl-CoA: 100.6
trans-1,2-CPDA: 97.1
CHC-CoA: 71.0
Isobutyryl-CoA: 50.4
Acetyl-CoA: 49.3
Benzoyl-CoA: 39.0
fatty_acid: 38.7
3-Methylbutyryl-CoA: 31.8
inactive: 31.2

PKS_AT (2083..2387): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.4
inactive: 85.6
Methoxymalonyl-CoA: 84.4
Methylmalonyl-CoA: 83.4
Ethylmalonyl-CoA: 51.5
Isobutyryl-CoA: 50.8
Propionyl-CoA: 45.1
Acetyl-CoA: 34.7
CHC-CoA: 30.2
2-Methylbutyryl-CoA: 24.5
trans-1,2-CPDA: 22.2
Benzoyl-CoA: 21.4
fatty_acid: 16.0
3-Methylbutyryl-CoA: 1.5

CDS_02694: mal

PKS_AT (570..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.2
inactive: 101.6
Methoxymalonyl-CoA: 66.1
Methylmalonyl-CoA: 50.2
Propionyl-CoA: 33.4
Ethylmalonyl-CoA: 26.9
Acetyl-CoA: 22.0
CHC-CoA: 19.8
Benzoyl-CoA: 19.2
2-Methylbutyryl-CoA: 19.0
Isobutyryl-CoA: 16.3
fatty_acid: 12.1
trans-1,2-CPDA: 8.9
3-Methylbutyryl-CoA: 0.0

CDS_02699: X

AMP-binding (43..361): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLGAVAAVAK
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

CDS_02702: X

AMP-binding (11..378): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --LFVGRITK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
OsdR	Development and stress management regulator

NPDC003500.ctg-0005 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 160,243 - 206,092 nt. (total: 45,850 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

CDS_02723: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

CDS_02749: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

CDS_02725: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthase

CDS_02736: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002387.2	0.44	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000044.3	0.41	PKS	dawenol	Stigmatella aurantiaca DW4/3-1
BGC0000894.4	0.40	other (other)	citrinin	Monascus aurantiacus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002387.2	0.44	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000044.3	0.41	PKS	dawenol	Stigmatella aurantiaca DW4/3-1
BGC0000894.4	0.40	other (other)	citrinin	Monascus aurantiacus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.94 out of 23.79

Confidence: medium

Additional weak hits (16):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.29 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.82 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.12 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.06 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.52 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.25 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.56 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.08 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.87 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.99 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

CDS_02736: mal

PKS_AT (612..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 79.0
Methoxymalonyl-CoA: 51.0
Methylmalonyl-CoA: 46.9
inactive: 33.0
fatty_acid: 30.5
Propionyl-CoA: 29.3
Ethylmalonyl-CoA: 21.8
Isobutyryl-CoA: 20.6
Acetyl-CoA: 18.0
2-Methylbutyryl-CoA: 15.5
CHC-CoA: 15.4
trans-1,2-CPDA: 15.0
Benzoyl-CoA: 10.3
3-Methylbutyryl-CoA: 4.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

NPDC003500.ctg-0005 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 232,036 - 261,820 nt. (total: 29,785 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CDS_02780: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_02790: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase

CDS_02783: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: decarboxylase

CDS_02791: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Isomerases: isomerase

CDS_02782: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase

CDS_02781: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.76	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.73	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.72	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.61	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0000244.4	0.61	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002620.2	0.60	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.76	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.73	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.72	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.61	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0000244.4	0.61	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002620.2	0.60	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.19 out of 36.53

Confidence: medium

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.36 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.39 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.29 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.84 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.37 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
MexT	Global virulence regulator

NPDC003500.ctg-0005 - Region 4 - NRPS,NRPS-like,PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 277,431 - 345,360 nt. (total: 67,930 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

CDS_02814: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: esterase

CDS_02828: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

CDS_02816: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_02830: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_02833: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_02834: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_02835: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_02837: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_02838: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_02840: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CDS_02843: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	2.09	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.88	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	1.88	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	1.84	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.83	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	1.75	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	1.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002164.2	1.72	NRPS	peramine	Epichloe festucae
BGC0002135.2	1.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.99 out of 29.25

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.61 out of 25.31

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.50 out of 30.25

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.85 out of 27.18

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.12 out of 27.04

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 277430 - 345360:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 277430 - 320073:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 282553 - 324914:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 286556 - 342021:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 304349 - 345360:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_02830: X

AMP-binding (20..414): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAHHLGGINK
Nearest Stachelhaus code(s):: Leu or Phe DAIMLGGIAK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

CDS_02833: X

AMP-binding (163..559): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMTHVGGFAK
Nearest Stachelhaus code(s):: Glu DAMHVGGTAK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

CDS_02835: X

AMP-binding (27..410): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAVVIGVVLK
Nearest Stachelhaus code(s):: aIle DALVFGVVLK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

CDS_02837: mal

PKS_AT (530..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 123.8
Methylmalonyl-CoA: 63.1
Methoxymalonyl-CoA: 62.0
inactive: 58.4
Propionyl-CoA: 37.7
2-Methylbutyryl-CoA: 33.4
CHC-CoA: 31.8
Ethylmalonyl-CoA: 31.7
Benzoyl-CoA: 30.9
Isobutyryl-CoA: 25.8
Acetyl-CoA: 24.4
fatty_acid: 21.4
trans-1,2-CPDA: 16.9
3-Methylbutyryl-CoA: 12.4

CDS_02838: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (462..860): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLIDK
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NPDC003500.ctg-0005 - Region 5 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 348,392 - 369,435 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

CDS_02872: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002699.2	0.47	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002699.2	0.47	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CDS_02872: PT_FPPS_like

Domain 1 (49 - 316): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.53 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NPDC003500.ctg-0005 - Region 6 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 433,235 - 500,861 nt. (total: 67,627 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxygenase

CDS_02963: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CDS_02967: flavodoxin

smcogs: SMCOG1134: flavodoxin

CDS_02974: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: methyltransferase

CDS_02951: methyltransferase

smcogs: SMCOG1089: methyltransferase

CDS_02958: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: esterase hydrolase

CDS_02954: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

CDS_02970: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase dehydratase hydratase

CDS_02983: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

CDS_02988: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

CDS_02998: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

CDS_02969: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_02972: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_02973: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_02976: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_02977: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

CDS_02962: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.25	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.22	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	1.19	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	1.18	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.14	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.12	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	1.12	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	1.11	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	1.10	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	1.10	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

Additional weak hits (26):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.96 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.61 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.62 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.44 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.56 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.47 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.10 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.11 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.90 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.32 out of 36.54

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.03 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.86 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.21 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.50 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.67 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.83 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.76 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.63 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 433234 - 500861:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 433234 - 476696:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 442099 - 500861:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_02969: X

AMP-binding (15..393): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAPHLGGFAK
Nearest Stachelhaus code(s):: Leu or Val DAIALGGCAK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

CDS_02972: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (27..410): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFLGGVLK
Nearest Stachelhaus code(s):: Val DAMFVGGVFK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

CDS_02973: mal

PKS_AT (535..820): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.2
inactive: 106.3
Methoxymalonyl-CoA: 72.1
Methylmalonyl-CoA: 64.7
Propionyl-CoA: 50.4
Isobutyryl-CoA: 43.3
Benzoyl-CoA: 35.7
Ethylmalonyl-CoA: 34.5
CHC-CoA: 32.9
Acetyl-CoA: 30.7
fatty_acid: 28.7
2-Methylbutyryl-CoA: 26.3
trans-1,2-CPDA: 19.1
3-Methylbutyryl-CoA: 15.2

CDS_02976: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (454..842): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (85% 8Å match); OH-Asn or Asn DLTKVGEVGK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

CDS_02977: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (496..901): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0006 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 69,259 - 91,404 nt. (total: 22,146 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

CDS_03132: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

CDS_03137: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase hydrolase

CDS_03133: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CDS_03140: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: hydratase

CDS_03131: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthetase

CDS_03136: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.52	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.52	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus
BGC0000645.3	0.48	terpene	carotenoid	Halobacillus halophilus DSM 2266

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

CDS_03135: PT_phytoene_like

Domain 1 (5 - 288): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

CDS_03136: PT_FPPS_like

Domain 1 (68 - 362): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.65 out of 27.04

Confidence: medium

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NPDC003500.ctg-0007 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 10,363 nt. (total: 10,363 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_03555: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

CDS_03549: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: hydratase

CDS_03550: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

CDS_03558: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001007.5	0.46	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.44	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000623.3	0.43	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000554.4	0.40	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002260.3	0.40	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.40	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001007.5	0.46	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.44	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0000623.3	0.43	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000554.4	0.40	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002260.3	0.40	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.40	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NPDC003500.ctg-0007 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 154,827 - 175,777 nt. (total: 20,951 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_03701: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

CDS_03697: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

CDS_03694: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

CDS_03695: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.56	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.55	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002699.2	0.47	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.56	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.55	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002699.2	0.47	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

CDS_03694: T1TS

Domain 1 (6 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

Additional weak hits (4):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.27 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.81 out of 20.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor

NPDC003500.ctg-0007 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 229,132 - 250,214 nt. (total: 21,083 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_03759: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

CDS_03763: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001456.3	0.39	terpene	isorenieratene	Streptomyces argillaceus
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4
BGC0000664.5	0.39	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000633.3	0.38	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.38	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000645.3	0.37	terpene	carotenoid	Halobacillus halophilus DSM 2266

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000648.3	0.40	terpene	carotenoid	Myxococcus xanthus
BGC0001456.3	0.39	terpene	isorenieratene	Streptomyces argillaceus
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4
BGC0000664.5	0.39	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000633.3	0.38	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.38	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000645.3	0.37	terpene	carotenoid	Halobacillus halophilus DSM 2266

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CDS_03763: PT_FPPS_like

Domain 1 (44 - 351): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.95 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.70 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.82 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.66 out of 29.25

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NPDC003500.ctg-0009 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 77,530 - 98,732 nt. (total: 21,203 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CDS_04414: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002690.2	0.42	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000844.5	0.39	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002316.2	0.38	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0002669.2	0.37	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000495.5	0.37	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002690.2	0.42	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0000503.5	0.40	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000844.5	0.39	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002316.2	0.38	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0002669.2	0.37	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000495.5	0.37	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

CDS_04413: Lycopene_cycl

Domain 1 (16 - 385): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.31 out of 23.43

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.90 out of 26.12

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NPDC003500.ctg-0010 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 133,591 - 154,658 nt. (total: 21,068 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CDS_04773: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Ligases: synthetase

CDS_04781: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.45	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.42	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002398.2	0.37	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.36	terpene	raimonol	Streptomyces anulatus
BGC0000643.3	0.35	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.34	terpene	carotenoid	Brevundimonas sp. SD212
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.45	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.42	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002398.2	0.37	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.36	terpene	raimonol	Streptomyces anulatus
BGC0000643.3	0.35	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.34	terpene	carotenoid	Brevundimonas sp. SD212
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CDS_04781: PT_FPPS_like

Domain 1 (42 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.71 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.19 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.57 out of 36.53

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NPDC003500.ctg-0011 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 185,799 - 206,764 nt. (total: 20,966 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_05066: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

CDS_05070: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

CDS_05065: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.45	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.44	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000905.5	0.36	other (other)	heme D1	Heliobacillus mobilis
BGC0001444.5	0.34	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000682.3	0.33	terpene	terretonin	Aspergillus terreus NIH2624
BGC0000157.5	0.32	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001850.4	0.32	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0000877.5	0.32	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.45	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.44	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000905.5	0.36	other (other)	heme D1	Heliobacillus mobilis
BGC0001444.5	0.34	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000682.3	0.33	terpene	terretonin	Aspergillus terreus NIH2624
BGC0000157.5	0.32	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001850.4	0.32	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0000877.5	0.32	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

CDS_05070: T1TS

Domain 1 (8 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.03 out of 23.43

Confidence: medium

Additional weak hits (11):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.60 out of 27.18

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.51 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.78 out of 28.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.85 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.91 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.27 out of 28.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.65 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator

NPDC003500.ctg-0012 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 149,398 - 190,450 nt. (total: 41,053 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_05231: Hydroxylation

MITE: MITE0000081Hydroxylation (identity: 77.50%)
smcogs: SMCOG1006: acyl-CoA dehydrogenase

CDS_05241: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: Prenylation aminotransferase methyltransferase

CDS_05218: methyltransferase

smcogs: SMCOG1089: methyltransferase

CDS_05229: Prenylation

MITE: MITE0000083Prenylation (identity: 60.00%)

CDS_05230: methyltransferase

smcogs: SMCOG1089: methyltransferase

CDS_05248: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deformylase

CDS_05224: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

CDS_05232: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.83	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001633.3	0.43	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000189.4	0.43	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.83	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001633.3	0.43	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000189.4	0.43	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.92 out of 23.79

Confidence: medium

Additional weak hits (15):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.62 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.36 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.05 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.57 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.10 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.20 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.48 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NPDC003500.ctg-0018 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 1,649 - 14,420 nt. (total: 12,772 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

CDS_06027: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

CDS_06029: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

CDS_06031: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: peptidase

CDS_06028: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0002083.3	0.31	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002169.3	0.31	NRPS, PKS	acurin A	Aspergillus aculeatus ATCC 16872
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001379.5	0.28	NRPS	BD-12	Streptomyces luteocolor
BGC0000806.5	0.28	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0002083.3	0.31	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002169.3	0.31	NRPS, PKS	acurin A	Aspergillus aculeatus ATCC 16872
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001379.5	0.28	NRPS	BD-12	Streptomyces luteocolor
BGC0000806.5	0.28	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.02 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0018 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 32,525 - 63,736 nt. (total: 31,212 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: decarboxylase

CDS_06062: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.59	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.58	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001531.5	0.49	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001870.3	0.46	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000940.5	0.45	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002683.2	0.43	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000244.4	0.42	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001948.3	0.42	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.59	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.58	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001531.5	0.49	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001870.3	0.46	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000940.5	0.45	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002683.2	0.43	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000244.4	0.42	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001948.3	0.42	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.54 out of 30.22

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.57 out of 36.53

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.76 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 25.75

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.83 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.31 out of 20.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.99 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.71 out of 36.53

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.75 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.92 out of 26.85

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence

NPDC003500.ctg-0020 - Region 1 - 2dos,NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 59,350 nt. (total: 59,350 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

CDS_06170: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CDS_06178: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

CDS_06189: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase glycosyltransferase methyltransferase

CDS_06169: methyltransferase

smcogs: SMCOG1089: methyltransferase

CDS_06179: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CDS_06184: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Hydrolases: esterase hydrolase

CDS_06168: thioesterase

smcogs: SMCOG1004: thioesterase

CDS_06177: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

CDS_06167: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_06171: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_06173: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

CDS_06175: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_06176: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	1.67	NRPS	AM-toxin	Alternaria alternata
BGC0001275.3	1.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001249.5	1.65	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	1.56	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002135.2	1.53	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.53	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.51	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.50	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.42 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.09 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.39 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.91 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.16 out of 23.43

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 59350:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (AHBA - ccmal - Me-redmal) + (Ile - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_06167: mal

PKS_AT (559..858): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.3
inactive: 95.5
Methoxymalonyl-CoA: 52.5
Methylmalonyl-CoA: 40.5
Propionyl-CoA: 27.1
Acetyl-CoA: 21.7
fatty_acid: 17.9
Benzoyl-CoA: 16.5
Isobutyryl-CoA: 16.0
Ethylmalonyl-CoA: 9.9
CHC-CoA: 2.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -0.0

CDS_06171: AHBA - mal - mmal

CAL_domain (35..442): AHBA

minowa: AHBA

Prediction, score:

AHBA: 388.3
shikimic_acid: 256.6
Acetyl-CoA: 8.6
fatty_acid: 0.0
NH2: 0.0

PKS_AT (1628..1926): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.2
inactive: 110.1
Methoxymalonyl-CoA: 64.1
Methylmalonyl-CoA: 46.0
Propionyl-CoA: 31.5
Ethylmalonyl-CoA: 23.0
Acetyl-CoA: 21.8
Benzoyl-CoA: 13.1
Isobutyryl-CoA: 11.4
fatty_acid: 10.9
trans-1,2-CPDA: 5.2
CHC-CoA: 4.9
3-Methylbutyryl-CoA: 2.5
2-Methylbutyryl-CoA: -4.1

PKS_AT (3349..3645): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 221.3
Ethylmalonyl-CoA: 211.5
Methoxymalonyl-CoA: 177.3
2-Methylbutyryl-CoA: 147.4
trans-1,2-CPDA: 129.4
Malonyl-CoA: 119.2
Propionyl-CoA: 104.3
CHC-CoA: 98.2
Isobutyryl-CoA: 82.5
Benzoyl-CoA: 70.5
Acetyl-CoA: 65.3
inactive: 39.6
fatty_acid: 33.1
3-Methylbutyryl-CoA: 21.8

CDS_06175: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (221..609): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAGFIGAVAK
Nearest Stachelhaus code(s):: Ile DAGFIGAVFK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)

CDS_06176: X

AMP-binding (224..613): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGFTAAVAK
Nearest Stachelhaus code(s):: Gly DVGYLIAVAK (56% 8Å match); Hty DLGFTGAVCK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0021 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 44,194 - 58,693 nt. (total: 14,500 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CDS_06237: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_06246: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0001910.4	0.49	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.47	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000286.3	0.41	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002221.2	0.39	terpene	ent-kauren-16alpha-ol	Serpula lacrymans var. lacrymans S7.9
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001840.2	0.36	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0001910.4	0.49	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.47	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000286.3	0.41	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002221.2	0.39	terpene	ent-kauren-16alpha-ol	Serpula lacrymans var. lacrymans S7.9
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001840.2	0.36	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

CDS_06244: T2TS

Domain 1 (18 - 504): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

Additional weak hits (1):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.59 out of 31.73

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NPDC003500.ctg-0023 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 31,471 nt. (total: 31,471 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_06288: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase transferase

CDS_06287: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CDS_06291: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

CDS_06283: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CDS_06292: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

CDS_06285: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_06286: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.62	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.60	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0000275.4	0.56	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000271.5	0.55	PKS	spore pigment	Streptomyces avermitilis
BGC0001197.5	0.54	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001513.3	0.54	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001366.5	0.52	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002000.4	0.52	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.62	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.60	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0000275.4	0.56	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000271.5	0.55	PKS	spore pigment	Streptomyces avermitilis
BGC0001197.5	0.54	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001513.3	0.54	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001366.5	0.52	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002000.4	0.52	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

Additional weak hits (5):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.66 out of 23.43

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.12 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.66 out of 36.54

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.96 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 0 to 31471
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 643.0; E-value: 3.8e-196)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: acetyl-CoA_8: 529 Da
acetyl-CoA_9: 571 Da

CDS_06281: OXY (Score: 12.6; E-value: 0.00012)
CDS_06284: ACP (Score: 85.0; E-value: 6.3e-27)
CDS_06285: CLF 8|9 (Score: 643.0; E-value: 3.8e-196)
CDS_06286: KS (Score: 709.7; E-value: 2.5e-216)
CDS_06287: GT (Score: 367.6; E-value: 2.4e-112)
CDS_06288: KR (Score: 102.0; E-value: 9.9e-32)
CDS_06289: CYC C1-C18|C2-C19 (Score: 188.6; E-value: 1.1e-58)
CDS_06290: CYC C5-C14/C3-C16 (Score: 451.7; E-value: 1.6e-138)

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NPDC003500.ctg-0025 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 5,043 - 22,550 nt. (total: 17,508 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

CDS_06344: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

CDS_06345: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Translocases: permease

CDS_06335: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000540.5	0.45	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000529.5	0.37	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002343.3	0.36	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0001221.5	0.34	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000192.3	0.33	PKS	aclacinomycin	Streptomyces galilaeus
BGC0002805.2	0.30	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001335.5	0.29	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000540.5	0.45	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000529.5	0.37	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002343.3	0.36	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0001221.5	0.34	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000192.3	0.33	PKS	aclacinomycin	Streptomyces galilaeus
BGC0002805.2	0.30	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001335.5	0.29	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for CDS_06344

CDS_06343

Leader:

MAQLATVQPDVEGGTLDDFDLDIEFIEAGGTVEHI

Core:

IKMTEDNCGSTCASACTSC

Core with dehydrations:

IKMDhbEDNCysGDhaDhbCysADhaACysDhbDhaCys

antiSMASH-DB 4.0 matches for CDS_06343

100.0%

NZ_CP031263.1and 5 others:

NZ_CP031263.1 Lanthipeptides: DVH21_RS29475_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS21965_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS21965_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS10570_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS10570_lanthipeptide

Lanthipeptides: DVH21_RS29475_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

IKMTEDNCGSTCASACTSC

1

IKMTEDNCGSTCASACTSC

19

89.5%

NZ_FMCU01000028.1and 1 other:

NZ_FMCU01000028.1 Lanthipeptides: GA0070216_RS31340_lanthipeptide

Lanthipeptides: GA0070216_RS31340_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

IKMTED+CGSTC SACTSC

1

IKMTEDSCGSTCESACTSC

19

78.9%

NZ_LT629758.1and 2 others:

NZ_LT629758.1 Lanthipeptides: BLU81_RS12595_lanthipeptideNZ_LT629758.1 Lanthipeptides: BLU81_RS12595_lanthipeptide

Lanthipeptides: BLU81_RS12595_lanthipeptide

2

KMTEDNCGSTCASACTSC

19

KMT DNCG+TC SACTSC

1

KMTGDNCGTTCESACTSC

18

with 152 more sequence matches

Only the first 10 are displayed here.

73.7%

NZ_KL997433.1and 1 other:

NZ_KL997433.1 Lanthipeptides: IQ62_RS26155_lanthipeptide

Lanthipeptides: IQ62_RS26155_lanthipeptide

3

MTEDNCGSTCASACTSC

19

+T+D CGSTCASACTSC

1

LTDDGCGSTCASACTSC

17

71.4%

NZ_AP024745.1and 1 other:

NZ_AP024745.1 Lanthipeptides: L3i22_RS11845_lanthipeptide

Lanthipeptides: L3i22_RS11845_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

IKMT DNCG+TC SACT+C

3

IKMTGDNCGTTCQSACTTC

21

63.6%

NZ_AZVD01000043.1and 3 others:

NZ_AZVD01000043.1 Lanthipeptides: K389_RS1000000127440_lanthipeptideNZ_KB898438.1 Lanthipeptides: D462_RS1000000129145_lanthipeptideNZ_KB898438.1 Lanthipeptides: D462_RS1000000129145_lanthipeptide

Lanthipeptides: K389_RS1000000127440_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

++ T DNCG TCASACTSC

2

LRSTSDNCGGTCASACTSC

20

63.6%

NZ_CP026652.1and 1 other:

NZ_CP026652.1 Lanthipeptides: C4B68_RS00400_lanthipeptide

Lanthipeptides: C4B68_RS00400_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

I++T D CGSTC SACTSC

3

IRLTNDGCGSTCQSACTSC

21

63.6%

NZ_CP061725.1and 1 other:

NZ_CP061725.1 Lanthipeptides: ID554_RS13020_lanthipeptide

Lanthipeptides: ID554_RS13020_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

++ T DNCG TCASACTSC

2

MRSTSDNCGKTCASACTSC

20

63.6%

NZ_JAPZVP010000006.1and 1 other:

NZ_JAPZVP010000006.1 Lanthipeptides: O1R50_RS08905_lanthipeptide

Lanthipeptides: O1R50_RS08905_lanthipeptide

4

TEDNCGSTCASACTSC

19

T D CGSTCASACTSC

6

TSDGCGSTCASACTSC

21

63.2%

NZ_FAOZ01000022.1:

Lanthipeptides: AWX74_RS26225_lanthipeptide

4

TEDNCGSTCASACTS

18

T D CGSTCASAC S

4

TSDTCGSTCASACAS

18

60.9%

NZ_CP119143.1and 1 other:

NZ_CP119143.1 Lanthipeptides: PYR72_RS32440_lanthipeptide

Lanthipeptides: PYR72_RS32440_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

I+MT+D C STCA+ACTSC

3

IRMTDDGCNSTCATACTSC

21

60.0%

NZ_CP070496.1and 1 other:

NZ_CP070496.1 Lanthipeptides: JQS30_RS06000_lanthipeptide

Lanthipeptides: JQS30_RS06000_lanthipeptide

4

TEDNCGSTCASACTSC

19

T DNCG TC SAC SC

4

TSDNCGHTCQSACVSC

19

60.0%

NZ_FNAD01000008.1and 1 other:

NZ_FNAD01000008.1 Lanthipeptides: BLQ63_RS15370_lanthipeptide

Lanthipeptides: BLQ63_RS15370_lanthipeptide

4

TEDNCGSTCASACTSC

19

T DNCG TC SAC SC

4

TGDNCGQTCQSACNSC

19

Lanthipeptide(s) for CDS_06346

CDS_06343

Leader:

MAQLATVQPDVEGGTLDDFDLDIEFIEAGGTVEHI

Core:

IKMTEDNCGSTCASACTSC

Core with dehydrations:

IKMDhbEDNCysGDhaDhbCysADhaACysDhbDhaCys

antiSMASH-DB 4.0 matches for CDS_06343

100.0%

NZ_CP031263.1and 5 others:

NZ_CP031263.1 Lanthipeptides: DVH21_RS29475_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS21965_lanthipeptideNZ_CP084582.1 Lanthipeptides: LF814_RS21965_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS10570_lanthipeptideNZ_CP118233.1 Lanthipeptides: PVK74_RS10570_lanthipeptide

Lanthipeptides: DVH21_RS29475_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

IKMTEDNCGSTCASACTSC

1

IKMTEDNCGSTCASACTSC

19

89.5%

NZ_FMCU01000028.1and 1 other:

NZ_FMCU01000028.1 Lanthipeptides: GA0070216_RS31340_lanthipeptide

Lanthipeptides: GA0070216_RS31340_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

IKMTED+CGSTC SACTSC

1

IKMTEDSCGSTCESACTSC

19

78.9%

NZ_LT629758.1and 2 others:

NZ_LT629758.1 Lanthipeptides: BLU81_RS12595_lanthipeptideNZ_LT629758.1 Lanthipeptides: BLU81_RS12595_lanthipeptide

Lanthipeptides: BLU81_RS12595_lanthipeptide

2

KMTEDNCGSTCASACTSC

19

KMT DNCG+TC SACTSC

1

KMTGDNCGTTCESACTSC

18

with 152 more sequence matches

Only the first 10 are displayed here.

73.7%

NZ_KL997433.1and 1 other:

NZ_KL997433.1 Lanthipeptides: IQ62_RS26155_lanthipeptide

Lanthipeptides: IQ62_RS26155_lanthipeptide

3

MTEDNCGSTCASACTSC

19

+T+D CGSTCASACTSC

1

LTDDGCGSTCASACTSC

17

71.4%

NZ_AP024745.1and 1 other:

NZ_AP024745.1 Lanthipeptides: L3i22_RS11845_lanthipeptide

Lanthipeptides: L3i22_RS11845_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

IKMT DNCG+TC SACT+C

3

IKMTGDNCGTTCQSACTTC

21

63.6%

NZ_AZVD01000043.1and 3 others:

NZ_AZVD01000043.1 Lanthipeptides: K389_RS1000000127440_lanthipeptideNZ_KB898438.1 Lanthipeptides: D462_RS1000000129145_lanthipeptideNZ_KB898438.1 Lanthipeptides: D462_RS1000000129145_lanthipeptide

Lanthipeptides: K389_RS1000000127440_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

++ T DNCG TCASACTSC

2

LRSTSDNCGGTCASACTSC

20

63.6%

NZ_CP026652.1and 1 other:

NZ_CP026652.1 Lanthipeptides: C4B68_RS00400_lanthipeptide

Lanthipeptides: C4B68_RS00400_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

I++T D CGSTC SACTSC

3

IRLTNDGCGSTCQSACTSC

21

63.6%

NZ_CP061725.1and 1 other:

NZ_CP061725.1 Lanthipeptides: ID554_RS13020_lanthipeptide

Lanthipeptides: ID554_RS13020_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

++ T DNCG TCASACTSC

2

MRSTSDNCGKTCASACTSC

20

63.6%

NZ_JAPZVP010000006.1and 1 other:

NZ_JAPZVP010000006.1 Lanthipeptides: O1R50_RS08905_lanthipeptide

Lanthipeptides: O1R50_RS08905_lanthipeptide

4

TEDNCGSTCASACTSC

19

T D CGSTCASACTSC

6

TSDGCGSTCASACTSC

21

63.2%

NZ_FAOZ01000022.1:

Lanthipeptides: AWX74_RS26225_lanthipeptide

4

TEDNCGSTCASACTS

18

T D CGSTCASAC S

4

TSDTCGSTCASACAS

18

60.9%

NZ_CP119143.1and 1 other:

NZ_CP119143.1 Lanthipeptides: PYR72_RS32440_lanthipeptide

Lanthipeptides: PYR72_RS32440_lanthipeptide

1

IKMTEDNCGSTCASACTSC

19

I+MT+D C STCA+ACTSC

3

IRMTDDGCNSTCATACTSC

21

60.0%

NZ_CP070496.1and 1 other:

NZ_CP070496.1 Lanthipeptides: JQS30_RS06000_lanthipeptide

Lanthipeptides: JQS30_RS06000_lanthipeptide

4

TEDNCGSTCASACTSC

19

T DNCG TC SAC SC

4

TSDNCGHTCQSACVSC

19

60.0%

NZ_FNAD01000008.1and 1 other:

NZ_FNAD01000008.1 Lanthipeptides: BLQ63_RS15370_lanthipeptide

Lanthipeptides: BLQ63_RS15370_lanthipeptide

4

TEDNCGSTCASACTSC

19

T DNCG TC SAC SC

4

TGDNCGQTCQSACNSC

19

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.92 out of 23.79

Confidence: medium

Additional weak hits (4):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.83 out of 23.43

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

CDS_06343 - Class I

Cleavage pHMM score: -10.50

RODEO score: 18

Monoisotopic mass: 1815.7 Da

Molecular weight: 1817.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1835.1 Da N = 1; 1853.1 Da N = 2

CDS_06343 - Class I

Cleavage pHMM score: -10.50

RODEO score: 18

Monoisotopic mass: 1815.7 Da

Molecular weight: 1817.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1835.1 Da N = 1; 1853.1 Da N = 2

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 150 - 241; Score: 48.0

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism