Streptomyces_roseoverticillatus_NRRL_B-3500 - 48 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JOFL01000001.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene-precursor,T1PKS	6,463	67,102
Region 1.2	NRPS,NRPS-like,RiPP-like	131,444	186,840	High	antipain	NRPS:Type I
Region 1.3	terpene-precursor	192,379	213,464
Region 1.4	NRPS-like,arylpolyene	215,139	258,125
Region 1.5	terpene-precursor,RiPP-like	308,549	329,601
Region 1.6	NRPS,T1PKS	391,077	442,127
Region 1.7	terpene	446,661	467,857

JOFL01000002.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-iii	24,813	47,686	Low	informatipeptin	ribosomal:RiPP:Lanthipeptide

JOFL01000003.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NRPS,NRPS-like	1	43,513
Region 3.2	NRPS,polyyne,T1PKS,terpene,NRPS-like	232,575	334,328	Low	cepacin A	PKS

JOFL01000004.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	lanthipeptide-class-iv	19,353	42,127
Region 4.2	hydrogen-cyanide	175,702	188,815

JOFL01000006.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	T1PKS,terpene	91,428	137,389	Medium	toxoflavin/fervenulin	other:other
Region 6.2	NRPS,transAT-PKS,T1PKS,terpene	178,806	313,414	High	kirromycin	NRPS:Type I+PKS:Type I
Region 6.3	crocagin	329,827	357,798
Region 6.4	butyrolactone	380,735	391,910
Region 6.5	T1PKS	422,039	467,333	Low	nematophin	NRPS:Type I
Region 6.6	lanthipeptide-class-i,terpene	467,923	494,263
Region 6.7	phosphonate	496,244	519,716
Region 6.8	T1PKS	583,312	633,816	Low	nystatin	PKS

JOFL01000007.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	T2PKS	82,219	154,740	High	FD-594	PKS

JOFL01000009.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	melanin	74,995	85,393	Low	melanin	other:other

JOFL01000010.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	ectoine	100,604	111,002	High	ectoine	other:other

JOFL01000013.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	T3PKS,terpene	79,599	129,859	Low	vazabitide A	NRPS:Type I

JOFL01000014.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	terpene	38,230	59,279

JOFL01000015.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	NI-siderophore	1	22,032	Low	peucechelin	NRPS:Type I

JOFL01000016.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	terpene,NAPAA	1	47,257	Medium	hopene	terpene
Region 16.2	prodigiosin,NRPS-like,T1PKS	51,646	103,505	High	marineosin A/marineosin B	PKS
Region 16.3	RiPP-like	109,719	120,186
Region 16.4	NRP-metallophore,NRPS	152,698	201,491	High	paenibactin	NRPS:Type I
Region 16.5	lanthipeptide-class-ii	269,193	292,429	Medium	cinnamycin	ribosomal:RiPP:Lanthipeptide

JOFL01000017.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	NAPAA	87,498	121,643

JOFL01000020.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	T1PKS,butyrolactone,NRP-metallophore,NRPS	3,490	101,698	High	qinichelins	NRPS:Type I

JOFL01000021.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	NI-siderophore	58,056	91,077

JOFL01000022.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	butyrolactone	43,083	54,246
Region 22.2	lassopeptide	69,781	92,316	Low	TVA-YJ-2	ribosomal:RiPP

JOFL01000024.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	NAPAA,CDPS	6,290	41,298	Low	γ-poly-L-2,4-diaminobutyric acid	NRPS:Type I
Region 24.2	terpene-precursor	71,033	88,565

JOFL01000027.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	terpene	18,080	39,141	Medium	paerucumarin	other:other

JOFL01000028.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	other,T1PKS	10,530	69,975	Medium	eurocidin D/eurocidin E	NRPS:Type I+PKS:Type I

JOFL01000033.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	terpene	61,197	82,096

JOFL01000034.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	terpene,T1PKS	7,087	59,298

JOFL01000035.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 35.1	NRPS-like	10,297	53,797

JOFL01000043.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 43.1	lassopeptide	2,877	19,548	High	lagmysin	ribosomal:RiPP

JOFL01000044.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 44.1	T1PKS	1	19,428	Low	tetramycin B	PKS

JOFL01000046.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	T2PKS	1	15,366	Low	prejadomycin/rabelomycin/gaudimycin C/gaudimycin D/UWM6/gaudimycin A	PKS:Type II+saccharide:hybrid/tailoring

JOFL01000051.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 51.1	T1PKS	1	6,054

JOFL01000057.1 (Streptomyces roseoverticillatus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 57.1	T1PKS	1	3,522

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene-precursor,T1PKS	6,463	67,102
Region 1.2	NRPS,NRPS-like,RiPP-like	131,444	186,840	High	antipain	NRPS:Type I
Region 1.3	terpene-precursor	192,379	213,464
Region 1.4	NRPS-like,arylpolyene	215,139	258,125
Region 1.5	terpene-precursor,RiPP-like	308,549	329,601
Region 1.6	NRPS,T1PKS	391,077	442,127
Region 1.7	terpene	446,661	467,857
Region 2.1	lanthipeptide-class-iii	24,813	47,686	Low	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 3.1	NRPS,NRPS-like	1	43,513
Region 3.2	NRPS,polyyne,T1PKS,terpene,NRPS-like	232,575	334,328	Low	cepacin A	PKS
Region 4.1	lanthipeptide-class-iv	19,353	42,127
Region 4.2	hydrogen-cyanide	175,702	188,815
Region 6.1	T1PKS,terpene	91,428	137,389	Medium	toxoflavin/fervenulin	other:other
Region 6.2	NRPS,transAT-PKS,T1PKS,terpene	178,806	313,414	High	kirromycin	NRPS:Type I+PKS:Type I
Region 6.3	crocagin	329,827	357,798
Region 6.4	butyrolactone	380,735	391,910
Region 6.5	T1PKS	422,039	467,333	Low	nematophin	NRPS:Type I
Region 6.6	lanthipeptide-class-i,terpene	467,923	494,263
Region 6.7	phosphonate	496,244	519,716
Region 6.8	T1PKS	583,312	633,816	Low	nystatin	PKS
Region 7.1	T2PKS	82,219	154,740	High	FD-594	PKS
Region 9.1	melanin	74,995	85,393	Low	melanin	other:other
Region 10.1	ectoine	100,604	111,002	High	ectoine	other:other
Region 13.1	T3PKS,terpene	79,599	129,859	Low	vazabitide A	NRPS:Type I
Region 14.1	terpene	38,230	59,279
Region 15.1	NI-siderophore	1	22,032	Low	peucechelin	NRPS:Type I
Region 16.1	terpene,NAPAA	1	47,257	Medium	hopene	terpene
Region 16.2	prodigiosin,NRPS-like,T1PKS	51,646	103,505	High	marineosin A/marineosin B	PKS
Region 16.3	RiPP-like	109,719	120,186
Region 16.4	NRP-metallophore,NRPS	152,698	201,491	High	paenibactin	NRPS:Type I
Region 16.5	lanthipeptide-class-ii	269,193	292,429	Medium	cinnamycin	ribosomal:RiPP:Lanthipeptide
Region 17.1	NAPAA	87,498	121,643
Region 20.1	T1PKS,butyrolactone,NRP-metallophore,NRPS	3,490	101,698	High	qinichelins	NRPS:Type I
Region 21.1	NI-siderophore	58,056	91,077
Region 22.1	butyrolactone	43,083	54,246
Region 22.2	lassopeptide	69,781	92,316	Low	TVA-YJ-2	ribosomal:RiPP
Region 24.1	NAPAA,CDPS	6,290	41,298	Low	γ-poly-L-2,4-diaminobutyric acid	NRPS:Type I
Region 24.2	terpene-precursor	71,033	88,565
Region 27.1	terpene	18,080	39,141	Medium	paerucumarin	other:other
Region 28.1	other,T1PKS	10,530	69,975	Medium	eurocidin D/eurocidin E	NRPS:Type I+PKS:Type I
Region 33.1	terpene	61,197	82,096
Region 34.1	terpene,T1PKS	7,087	59,298
Region 35.1	NRPS-like	10,297	53,797
Region 43.1	lassopeptide	2,877	19,548	High	lagmysin	ribosomal:RiPP
Region 44.1	T1PKS	1	19,428	Low	tetramycin B	PKS
Region 46.1	T2PKS	1	15,366	Low	prejadomycin/rabelomycin/gaudimycin C/gaudimycin D/UWM6/gaudimycin A	PKS:Type II+saccharide:hybrid/tailoring
Region 51.1	T1PKS	1	6,054
Region 57.1	T1PKS	1	3,522

No secondary metabolite regions were found in these records:: JOFL01000005.1 (Streptomyces roseoverticillatus); JOFL01000008.1 (Streptomyces roseoverticillatus); JOFL01000011.1 (Streptomyces roseoverticillatus); JOFL01000012.1 (Streptomyces roseoverticillatus); JOFL01000018.1 (Streptomyces roseoverticillatus); JOFL01000019.1 (Streptomyces roseoverticillatus); JOFL01000023.1 (Streptomyces roseoverticillatus); JOFL01000025.1 (Streptomyces roseoverticillatus); JOFL01000026.1 (Streptomyces roseoverticillatus); JOFL01000029.1 (Streptomyces roseoverticillatus); JOFL01000030.1 (Streptomyces roseoverticillatus); JOFL01000031.1 (Streptomyces roseoverticillatus); JOFL01000032.1 (Streptomyces roseoverticillatus); JOFL01000036.1 (Streptomyces roseoverticillatus); JOFL01000037.1 (Streptomyces roseoverticillatus); JOFL01000038.1 (Streptomyces roseoverticillatus); JOFL01000039.1 (Streptomyces roseoverticillatus); JOFL01000040.1 (Streptomyces roseoverticillatus); JOFL01000041.1 (Streptomyces roseoverticillatus); JOFL01000042.1 (Streptomyces roseoverticillatus); JOFL01000045.1 (Streptomyces roseoverticillatus); JOFL01000047.1 (Streptomyces roseoverticillatus); JOFL01000048.1 (Streptomyces roseoverticillatus); JOFL01000049.1 (Streptomyces roseoverticillatus); JOFL01000050.1 (Streptomyces roseoverticillatus); JOFL01000052.1 (Streptomyces roseoverticillatus); JOFL01000053.1 (Streptomyces roseoverticillatus); JOFL01000054.1 (Streptomyces roseoverticillatus); JOFL01000055.1 (Streptomyces roseoverticillatus); JOFL01000056.1 (Streptomyces roseoverticillatus); JOFL01000058.1 (Streptomyces roseoverticillatus); JOFL01000059.1 (Streptomyces roseoverticillatus); JOFL01000060.1 (Streptomyces roseoverticillatus); JOFL01000061.1 (Streptomyces roseoverticillatus); JOFL01000062.1 (Streptomyces roseoverticillatus); JOFL01000063.1 (Streptomyces roseoverticillatus); JOFL01000064.1 (Streptomyces roseoverticillatus)

Compact view

JOFL01000001.1 - Region 1 - T1PKS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 6,463 - 67,102 nt. (total: 60,640 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

ctg1_12: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

ctg1_33: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg1_38: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acetyltransferase acylase aminotransferase methyltransferase

ctg1_19: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

ctg1_20: methyltransferase

smcogs: SMCOG1089: methyltransferase

ctg1_28: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

ctg1_42: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: dehydratase

ctg1_26: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthetase

ctg1_17: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.30	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.30	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.30	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.30	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.29	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.27	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.26	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.26	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.26	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.3	0.26	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg1_17: PT_FPPS_like

Domain 1 (59 - 343): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.04 out of 27.55

Confidence: medium

Additional weak hits (19):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.05 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.51 out of 30.22

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.23 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.41 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.77 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.36 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.89 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.31 out of 26.06

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.76 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.11 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.23 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.20 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.41 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.58 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 6462 - 67102:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 23040 - 67102:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg1_42: mmal

PKS_AT (560..853): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 79.2%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 150.2
Ethylmalonyl-CoA: 128.5
Methoxymalonyl-CoA: 114.1
Malonyl-CoA: 89.3
Propionyl-CoA: 87.2
2-Methylbutyryl-CoA: 83.3
trans-1,2-CPDA: 55.6
3-Methylbutyryl-CoA: 52.4
Benzoyl-CoA: 50.0
Acetyl-CoA: 49.5
Isobutyryl-CoA: 46.4
CHC-CoA: 38.5
inactive: 25.4
fatty_acid: 22.2

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
GnfM	Regulator of nitrogen-fixation genes

JOFL01000001.1 - Region 2 - NRPS,NRPS-like,RiPP-like

Download region GenBank file

Download region SVG

Location: 131,444 - 186,840 nt. (total: 55,397 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg1_130: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg1_146: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase

ctg1_128: acyltransferase

smcogs: SMCOG1141: acyltransferase

Lyases: dehydratase

ctg1_148: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

ctg1_144: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg1_145: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg1_147: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (25):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.41 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.12 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.67 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.34 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.80 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.30 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.32 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.08 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.83 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.02 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.43 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.32 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.22 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.91 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.10 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.42 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.53 out of 24.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 131443 - 186840:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 131443 - 174593:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 135827 - 180048:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg1_145: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (466..866): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVENVGAITK
Nearest Stachelhaus code(s):: Arg DVENVGAITK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg1_147: Phe - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (31..432): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPLISGAVVK
Nearest Stachelhaus code(s):: Phe DPLVVGAVVK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (809..1205): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DGFFIGGSFK
Nearest Stachelhaus code(s):: Val DGFFVGGVFK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

JOFL01000001.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 192,379 - 213,464 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg1_185: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

ctg1_186: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

ctg1_190: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: synthase synthetase

ctg1_184: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

ctg1_191: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.53	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001909.3	0.39	PKS	strobilurin A	Strobilurus tenacellus
BGC0002309.2	0.39	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000664.5	0.39	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.38	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.37	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.53	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001909.3	0.39	PKS	strobilurin A	Strobilurus tenacellus
BGC0002309.2	0.39	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000664.5	0.39	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.38	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.37	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg1_184: PT_FPPS_like

Domain 1 (48 - 339): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.23 out of 29.51

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.41 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.52 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.96 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.16 out of 27.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.64 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.64 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

JOFL01000001.1 - Region 4 - NRPS-like,arylpolyene

Download region GenBank file

Download region SVG

Location: 215,139 - 258,125 nt. (total: 42,987 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg1_216: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: esterase hydrolase

ctg1_208: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

ctg1_210: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Ligases: ligase synthase

ctg1_211: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg1_212: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg1_213: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg1_227: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.52	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.52	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002174.2	0.52	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001251.4	0.51	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.51	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.51	NRPS	AbT1	Aureobasidium pullulans
BGC0002075.3	0.50	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.49	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000867.3	0.34	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001987.2	0.34	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001987.2	0.48	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.11 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.87 out of 23.79

Confidence: medium

Additional weak hits (11):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.85 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.08 out of 32.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.65 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.86 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.71 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg1_211: X

AMP-binding (58..446): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SSALVL---K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg1_212: X

AMP-binding (115..510): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSLCLACHVK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

JOFL01000001.1 - Region 5 - RiPP-like,terpene-precursor

Download region GenBank file

Download region SVG

Location: 308,549 - 329,601 nt. (total: 21,053 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg1_270: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: hydrolase

ctg1_272: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthetase

ctg1_278: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.41	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.35	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.29	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.28	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000688.4	0.24	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000678.5	0.24	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000664.5	0.23	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000665.5	0.23	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000644.3	0.22	terpene	carotenoid	Dietzia sp. CQ4
BGC0000649.3	0.21	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.43	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002346.3	0.43	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000706.3	0.42	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000503.5	0.42	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000688.4	0.41	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg1_278: PT_FPPS_like

Domain 1 (55 - 333): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (3):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.10 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000001.1 - Region 6 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 391,077 - 442,127 nt. (total: 51,051 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg1_355: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acetyltransferase acylase aminotransferase

ctg1_370: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

ctg1_371: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

ctg1_372: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: back translocase deacetylase

ctg1_364: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

ctg1_379: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: hydratase

ctg1_385: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.58	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.58	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (24):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.00 out of 27.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.18 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.17 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.15 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.37 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.45 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.55 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.02 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.40 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.77 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.88 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.40 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 391076 - 442127:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg1_371: X

AMP-binding (1535..1928): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALILGVVLK
Nearest Stachelhaus code(s):: aIle DALVFGVVLK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg1_372: mal

PKS_AT (551..846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; CE-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 136.9
Methylmalonyl-CoA: 73.5
inactive: 73.4
Propionyl-CoA: 60.1
Methoxymalonyl-CoA: 58.0
Ethylmalonyl-CoA: 41.9
Isobutyryl-CoA: 40.0
trans-1,2-CPDA: 28.2
2-Methylbutyryl-CoA: 27.7
Benzoyl-CoA: 27.5
Acetyl-CoA: 26.2
fatty_acid: 19.9
CHC-CoA: 19.1
3-Methylbutyryl-CoA: 8.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

JOFL01000001.1 - Region 7 - terpene

Download region GenBank file

Download region SVG

Location: 446,661 - 467,857 nt. (total: 21,197 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg1_402: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg1_405: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

ctg1_411: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg1_412: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

ctg1_403: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001197.5	0.47	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002496.3	0.40	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001873.3	0.39	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001197.5	0.47	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001911.3	0.42	terpene	raimonol	Streptomyces anulatus
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002496.3	0.40	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001873.3	0.39	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg1_403: T1TS

Domain 1 (10 - 318): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.78 out of 24.78

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.77 out of 29.72

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.04 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.67 out of 25.88

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.52 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

JOFL01000002.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 24,813 - 47,686 nt. (total: 22,874 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg2_32: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: glycosyltransferase methyltransferase

ctg2_40: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

ctg2_41: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.52	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001579.4	0.45	ribosomal	duramycin	Streptomyces cinnamoneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.52	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001579.4	0.45	ribosomal	duramycin	Streptomyces cinnamoneus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg2_34

ctg2_35

Leader:

MALLDLQNMESEANTGHGGGGQ

Core:

STVSLLSCVSTASVLICL

Core with dehydrations:

DhaDhbVDhaLLDhaCysVDhaDhbADhaVLICysL

antiSMASH-DB 4.0 matches for ctg2_35

90.0%

NZ_BMUT01000002.1and 3 others:

NZ_CP040752.1 Lanthipeptides: FGW37_RS09755_lanthipeptideNZ_LNBE01000004.1 Lanthipeptides: AS857_RS19855_lanthipeptideNZ_WPBY01000022.1 Lanthipeptides: GO001_RS24105_lanthipeptide

Lanthipeptides: IE241_RS08090_lanthipeptide

1

STVSLLSCVSTASVLICL

18

STVSLLSCVSTASVLICL

3

STVSLLSCVSTASVLICL

20

88.9%

NZ_BBYG01000010.1:

Lanthipeptides: AOQ37_RS09965_lanthipeptide

1

STVSLLSCVSTASVLICL

18

STVSLLSCVS ASVL+CL

1

STVSLLSCVSAASVLLCL

18

88.9%

NZ_CP072827.1:

Lanthipeptides: J7W19_RS28510_lanthipeptide

1

STVSLLSCVSTASVLICL

18

ST SLLSCVSTASVL+CL

1

STASLLSCVSTASVLLCL

18

with 54 more sequence matches

Only the first 10 are displayed here.

88.9%

NZ_CP092051.1:

Lanthipeptides: MCU78_RS03785_lanthipeptide

1

STVSLLSCVSTASVLICL

18

STVSLLSCVS ASVL+CL

1

STVSLLSCVSAASVLVCL

18

83.3%

NC_003155.5and 4 others:

NZ_KB891997.1 Lanthipeptides: B079_RS0125330_lanthipeptideNZ_KB912966.1 Lanthipeptides: B065_RS0120870_lanthipeptideNZ_MLCE01000039.1 Lanthipeptides: BKI49_RS34310_lanthipeptideNZ_MQUS01000001.1 Lanthipeptides: AV521_RS02305_lanthipeptide

Lanthipeptides: SAVERM_RS38515_lanthipeptide

2

TVSLLSCVSTASVLICL

18

TVSLLSCVS ASVL+CL

1

TVSLLSCVSAASVLLCL

17

83.3%

NZ_BMSE01000001.1and 20 others:

NZ_BMTM01000009.1 Lanthipeptides: IE213_RS27820_lanthipeptideNZ_BMUK01000002.1 Lanthipeptides: IE276_RS03565_lanthipeptideNZ_BMUO01000001.1 Lanthipeptides: IE232_RS00145_lanthipeptideNZ_CP015098.1 Lanthipeptides: A4E84_RS37870_lanthipeptideNZ_CP041604.2 Lanthipeptides: FNV64_RS48055_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS46395_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS47280_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS48480_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS47040_lanthipeptideNZ_CP049838.1 Lanthipeptides: G9272_RS40085_lanthipeptideNZ_JACHCX010000007.1 Lanthipeptides: HDC93_RS16065_lanthipeptideNZ_JACHGV010000013.1 Lanthipeptides: HNR57_RS32395_lanthipeptideNZ_JACHXE010000001.1 Lanthipeptides: FHS41_RS01865_lanthipeptideNZ_KB911710.1 Lanthipeptides: H294_RS0120310_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KZ671983.1 Lanthipeptides: BV882_RS30460_lanthipeptideNZ_LMEQ01000023.1 Lanthipeptides: ASD48_RS25330_lanthipeptideNZ_LMIZ01000012.1 Lanthipeptides: ASE41_RS11285_lanthipeptideNZ_QFRX01000001.1 Lanthipeptides: DI272_RS05815_lanthipeptide

Lanthipeptides: IE153_RS00140_lanthipeptide

1

STVSLLSCVSTASVLICL

18

STVSLLSC+S ASVL+CL

1

STVSLLSCISAASVLLCL

18

83.3%

NZ_BMSI01000009.1:

Lanthipeptides: IE189_RS23215_lanthipeptide

1

STVSLLSCVSTASVLICL

18

STVSLLSCVS SVL+CL

1

STVSLLSCVSATSVLLCL

18

77.8%

NZ_AUKV01000001.1and 12 others:

NZ_BMWC01000009.1 Lanthipeptides: IE255_RS28335_lanthipeptideNZ_BNBR01000001.1 Lanthipeptides: IE308_RS02895_lanthipeptideNZ_CP023694.1 Lanthipeptides: CP976_RS39235_lanthipeptideNZ_CP026121.1 Lanthipeptides: C1703_RS37710_lanthipeptideNZ_CP029788.1 Lanthipeptides: DMT42_RS35020_lanthipeptideNZ_CP049780.1 Lanthipeptides: G7Z13_RS32285_lanthipeptideNZ_CP075896.1 Lanthipeptides: KJK29_RS01685_lanthipeptideNZ_CP094344.1 Lanthipeptides: MQE23_RS40865_lanthipeptideNZ_GG657757.1 Lanthipeptides: SSQG_RS35880_lanthipeptideNZ_JAPJYN010000013.1 Lanthipeptides: OR263_RS25210_lanthipeptideNZ_LIVZ01000003.1 Lanthipeptides: AMK31_RS09050_lanthipeptideNZ_LT963352.1 Lanthipeptides: SCNRRL3882_RS38195_lanthipeptide

Lanthipeptides: H305_RS0100085_lanthipeptide

2

TVSLLSCVSTASVLICL

18

TVSLLSC+S ASVL+CL

1

TVSLLSCISAASVLLCL

17

77.8%

NZ_BCMN01000008.1and 18 others:

NZ_CP016438.1 Lanthipeptides: SLINC_RS40935_lanthipeptideNZ_CP028834.1 Lanthipeptides: DBP13_RS03385_lanthipeptideNZ_CP032427.1 Lanthipeptides: DWG14_RS04755_lanthipeptideNZ_CP041168.1 Lanthipeptides: FJ654_RS37200_lanthipeptideNZ_CP063808.1 Lanthipeptides: IOD14_RS17380_lanthipeptideNZ_CP089312.1 Lanthipeptides: LUX31_RS01980_lanthipeptideNZ_CP090447.1 Lanthipeptides: LXH13_RS36110_lanthipeptideNZ_CP114283.1 Lanthipeptides: O1Q96_RS29865_lanthipeptideNZ_KB911777.1 Lanthipeptides: H295_RS0107720_lanthipeptideNZ_KE150426.1 Lanthipeptides: HMPREF1211_RS03610_lanthipeptideNZ_KQ948146.1 Lanthipeptides: AQI94_RS13060_lanthipeptideNZ_KQ948176.1 Lanthipeptides: AQI84_RS04025_lanthipeptideNZ_KQ948306.1 Lanthipeptides: AQI96_RS09745_lanthipeptideNZ_KQ948656.1 Lanthipeptides: AQJ46_RS04035_lanthipeptideNZ_KQ948737.1 Lanthipeptides: AQJ54_RS21815_lanthipeptideNZ_MJAH01000003.1 Lanthipeptides: BFN33_RS10675_lanthipeptideNZ_PZZX01000020.1 Lanthipeptides: C7821_RS36345_lanthipeptideNZ_SLYY01000001.1 Lanthipeptides: EV578_RS04115_lanthipeptide

Lanthipeptides: AV140_RS18455_lanthipeptide

1

STVSLLSCVSTASVLICL

18

ST+SLLSCVS ASV +CL

1

STLSLLSCVSAASVTLCL

18

77.8%

NZ_CM002285.1and 2 others:

NZ_CP047020.1 Lanthipeptides: GQF42_RS39440_lanthipeptideNZ_VISR01000012.1 Lanthipeptides: FB157_RS21700_lanthipeptide

Lanthipeptides: M878_RS54195_lanthipeptide

2

TVSLLSCVSTASVLICL

18

TVSLLSCVS AS+L+CL

1

TVSLLSCVSAASILLCL

17

77.8%

NZ_CP011497.1and 4 others:

NZ_CP017248.1 Lanthipeptides: BFF78_RS03720_lanthipeptideNZ_CP034687.1 Lanthipeptides: ELQ87_RS02805_lanthipeptideNZ_CP106795.1 Lanthipeptides: N8I86_RS33235_lanthipeptideNZ_LIWA01000002.1 Lanthipeptides: AMK32_RS11185_lanthipeptide

Lanthipeptides: ABB07_RS02975_lanthipeptide

2

TVSLLSCVSTASVLICL

18

T SLLSCVS ASVL+CL

1

TASLLSCVSAASVLLCL

17

77.8%

NZ_CP016279.1and 1 other:

NZ_KQ948226.1 Lanthipeptides: AQI95_RS36775_lanthipeptide

Lanthipeptides: AVL59_RS17635_lanthipeptide

2

TVSLLSCVSTASVLICL

18

T+SLLSCVS ASVL+CL

1

TLSLLSCVSAASVLLCL

17

77.8%

NZ_CP021978.1:

Lanthipeptides: CEB94_RS37585_lanthipeptide

1

STVSLLSCVSTASVLICL

18

ST+SLLSC+S ASVL+CL

1

STLSLLSCISAASVLLCL

18

MIBiG 4.0 matches for ctg2_35

45.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

STVSLLSC-VSTASVLIC

17

S VSLL C S+ SV++C

3

SQVSLLVCEYSSLSVVLC

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.24 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.58 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.73 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.54 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.25 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.45 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.40 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

ctg2_35 - Class III

Cleavage pHMM score: 10.60

RODEO score: 0

Monoisotopic mass: 1668.9 Da

Molecular weight: 1670.0 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1688.0 Da N = 1; 1706.1 Da N = 2; 1724.1 Da N = 3; 1742.1 Da N = 4; 1760.1 Da N = 5

TFBS definitions

Regulator	Description

JOFL01000003.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 43,513 nt. (total: 43,513 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg3_16: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

ctg3_21: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: esterase

ctg3_14: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

ctg3_10: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

ctg3_12: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg3_15: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg3_20: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg3_28: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: permease

ctg3_8: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

ctg3_9: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.88	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (17):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.11 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.16 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.83 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.36 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.43 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.50 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.24 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.68 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.74 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.95 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.84 out of 28.14

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.36 out of 29.51

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.13 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.64 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.17 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.03 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 43513:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 40389:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 1659 - 43513:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg3_12: X

AMP-binding (1125..1537): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSCEEGGVYK
Nearest Stachelhaus code(s):: meSer DVFESGGVAK (56% 8Å match); Lys DVFESGGVAK (50% 8Å match)
Stachelhaus code match:: 60% (weak)

ctg3_15: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (32..429): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDFGLVDK
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (79% 8Å match); Ile DAQDLGVVDK (76% 8Å match); OH-Orn DAQEGGLVDK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

JOFL01000003.1 - Region 2 - NRPS,NRPS-like,T1PKS,polyyne,terpene

Download region GenBank file

Download region SVG

Location: 232,575 - 334,328 nt. (total: 101,754 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
polyyne: ((PP-binding_2 or PP-binding) and delta9_cd03505 and delta12_cd03507 and FAAL_cd05931 and (4HBT_2 or Thioesterase or PF00561))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

ctg3_200: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg3_236: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg3_258: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

ctg3_260: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg3_261: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase kinase

ctg3_198: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

ctg3_275: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase hydrolase

ctg3_211: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

ctg3_215: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

ctg3_238: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase dehydratase

ctg3_250: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

ctg3_254: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: mutase

ctg3_209: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

ctg3_214: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg3_243: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg3_245: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg3_253: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg3_262: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg3_276: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.47	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.46	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.46	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.46	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	1.45	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	1.42	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001746.3	1.41	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002164.2	1.41	NRPS	peramine	Epichloe festucae
BGC0002582.3	1.38	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000683.3	1.38	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002582.3	0.78	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0001746.3	0.77	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002075.3	0.76	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg3_250: T1TS

Domain 1 (4 - 317): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.17 out of 23.79

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.02 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.09 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.03 out of 29.51

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.50 out of 30.12

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.34 out of 23.43

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

Additional weak hits (35):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.78 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.65 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.02 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.11 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.45 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.09 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.85 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.87 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.30 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.01 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.72 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.38 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.44 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.73 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.46 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 30.98

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.09 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.94 out of 18.57

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.37 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.43 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.56 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.02 out of 23.43

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.36 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 232574 - 334328:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - Thr) + (Me-pk) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 232574 - 279783:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 271571 - 324550:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 293350 - 334328:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg3_214: Arg - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (474..881): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DADDVGLVDK
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1543..1955): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg3_243: Acetyl-CoA

CAL_domain (31..481): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 47.0
fatty_acid: 20.8
AHBA: 8.8
shikimic_acid: 5.2
NH2: 3.7

ctg3_253: pk

PKS_AT (543..980): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 90.8
Malonyl-CoA: 81.4
Methoxymalonyl-CoA: 79.9
Isobutyryl-CoA: 64.0
Ethylmalonyl-CoA: 56.9
2-Methylbutyryl-CoA: 44.6
Propionyl-CoA: 41.6
Acetyl-CoA: 40.9
trans-1,2-CPDA: 34.3
inactive: 28.1
fatty_acid: 26.5
CHC-CoA: 20.3
3-Methylbutyryl-CoA: 13.7
Benzoyl-CoA: 13.1

ctg3_262: X

AMP-binding (27..434): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAIYSGFVVK
Nearest Stachelhaus code(s):: Leu DAWYLGNVVK (59% 8Å match); Leu or Ile DAIYLGVVLK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
ToxT	Regulator of MSHA biosynthesis

JOFL01000004.1 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 19,353 - 42,127 nt. (total: 22,775 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

ctg4_27: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001210.5	0.43	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000539.5	0.42	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0000521.3	0.41	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002635.2	0.40	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001210.5	0.43	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.5	0.43	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000539.5	0.42	ribosomal	nukacin ISK-1	Staphylococcus warneri
BGC0000521.3	0.41	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002635.2	0.40	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.89 out of 23.79

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.55 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.99 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.99 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.86 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

JOFL01000004.1 - Region 2 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 175,702 - 188,815 nt. (total: 13,114 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

ctg4_153: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

ctg4_155: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001558.5	0.26	PKS	cosmomycin C	Streptomyces sp. CNT302
BGC0000997.4	0.25	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0000842.5	0.22	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000806.5	0.22	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210
BGC0000084.5	0.20	PKS	laidlomycin	Streptomyces sp. CS684
BGC0001740.5	0.20	NRPS, PKS	phthoxazolin	Streptomyces avermitilis
BGC0002587.2	0.18	PKS	ossamycin	Streptomyces ossamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001558.5	0.26	PKS	cosmomycin C	Streptomyces sp. CNT302
BGC0000997.4	0.25	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0000842.5	0.22	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000806.5	0.22	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210
BGC0000084.5	0.20	PKS	laidlomycin	Streptomyces sp. CS684
BGC0001740.5	0.20	NRPS, PKS	phthoxazolin	Streptomyces avermitilis
BGC0002587.2	0.18	PKS	ossamycin	Streptomyces ossamyceticus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.02 out of 27.18

Confidence: medium

Additional weak hits (5):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.88 out of 21.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.74 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes
OsdR	Development and stress management regulator

JOFL01000006.1 - Region 1 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 91,428 - 137,389 nt. (total: 45,962 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase synthase

ctg6_104: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg6_85: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: methyltransferase

ctg6_78: methyltransferase

smcogs: SMCOG1089: methyltransferase

ctg6_83: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: synthase

ctg6_85: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: cyclase

ctg6_100: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

ctg6_92: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	1.10	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000683.3	0.89	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001746.3	0.89	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001959.4	0.51	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001972.4	0.36	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001276.3	0.32	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.31	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.31	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.31	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002134.4	0.30	other (other)	leupeptin A, leupeptin B, leupeptin D, leupeptin C	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001959.4	0.79	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0000683.3	0.75	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0001972.4	0.69	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

ctg6_100: T1TS + T1TS

Domain 1 (3 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (326 - 709): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

Additional weak hits (22):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.94 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.54 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.66 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.15 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.12 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.13 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.79 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.54 out of 19.26

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.72 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.97 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.63 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.29 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.54 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.59 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 91427 - 137389:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 91427 - 135303:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg6_92: pk

PKS_AT (541..834): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 132.7
Ethylmalonyl-CoA: 121.2
Malonyl-CoA: 105.5
Methoxymalonyl-CoA: 103.6
2-Methylbutyryl-CoA: 75.7
Propionyl-CoA: 67.1
Isobutyryl-CoA: 66.6
trans-1,2-CPDA: 65.2
fatty_acid: 47.8
CHC-CoA: 47.3
Acetyl-CoA: 45.7
Benzoyl-CoA: 36.3
3-Methylbutyryl-CoA: 31.6
inactive: 31.2

ctg6_93: X

AMP-binding (58..309): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --SAFG-VDK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg6_97: X

AMP-binding (481..686): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --GFFG-IEK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000006.1 - Region 2 - NRPS,T1PKS,terpene,transAT-PKS

Download region GenBank file

Download region SVG

Location: 178,806 - 313,414 nt. (total: 134,609 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

ctg6_164: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg6_171: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg6_174: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg6_176: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg6_199: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg6_205: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: PPTase acylase methyltransferase

ctg6_162: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

ctg6_163: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg6_166: methyltransferase

smcogs: SMCOG1089: methyltransferase

ctg6_167: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg6_172: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

ctg6_178: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg6_203: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase dehydratase

ctg6_196: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg6_202: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

ctg6_161: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg6_175: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg6_177: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg6_193: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.99	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.99	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.95	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.94	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001050.5	0.92	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000041.3	0.92	PKS	oronofacic acid	Pseudomonas syringae
BGC0001132.4	0.91	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.90	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.90	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.90	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.79	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0000657.5	0.73	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

ctg6_202: T1TS

Domain 1 (36 - 379): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.79 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

Additional weak hits (25):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.00 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.90 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.70 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.28 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.27 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.79 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.75 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.27 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.89 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.00 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.64 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.78 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.64 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.21 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.68 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.54 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.25 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.49 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.36 out of 32.93

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.04 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 178805 - 313414:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (bAla) + (ccmal - ccmal) + (Me-ccmal - ccmal - mal) + (Gly - ccmal) + (Me-ccmal - mal - ohmal - ohmal - ccmal) + (ccmal) + (Me-ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 178805 - 221892:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (bAla) + (ccmal - ccmal) + (Me-ccmal - ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 182915 - 295432:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (bAla) + (ccmal - ccmal) + (Me-ccmal - ccmal - mal) + (Gly - ccmal) + (Me-ccmal - mal - ohmal - ohmal - ccmal) + (ccmal) + (Me-ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 182915 - 286205:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (bAla) + (ccmal - ccmal) + (Me-ccmal - ccmal - mal) + (Gly - ccmal) + (Me-ccmal - mal - ohmal - ohmal - ccmal) + (ccmal) + (Me-ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg6_161: bAla

Search NORINE for peptide: strict or relaxed

AMP-binding (456..846): bAla

nrpys: bAla

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DTLQLGVIWK
Nearest Stachelhaus code(s):: bAla DTLQLGVIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg6_163: mal - mal

PKS_AT (6..297): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 57.0
Methylmalonyl-CoA: 30.4
Isobutyryl-CoA: 26.3
Propionyl-CoA: 25.0
Methoxymalonyl-CoA: 23.8
inactive: 21.6
2-Methylbutyryl-CoA: 17.8
Benzoyl-CoA: 13.8
fatty_acid: 12.1
CHC-CoA: 11.4
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (349..627): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 117.0
Methoxymalonyl-CoA: 39.6
inactive: 31.4
Methylmalonyl-CoA: 28.8
Propionyl-CoA: 28.2
fatty_acid: 17.5
Ethylmalonyl-CoA: 16.3
2-Methylbutyryl-CoA: 13.7
Acetyl-CoA: 12.7
trans-1,2-CPDA: 10.9
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg6_167: mmal

PKS_AT (91..387): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Propionyl-CoA: 75.0%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 149.1
Methoxymalonyl-CoA: 124.4
Ethylmalonyl-CoA: 118.7
Isobutyryl-CoA: 100.5
Benzoyl-CoA: 81.9
Malonyl-CoA: 80.1
trans-1,2-CPDA: 79.9
2-Methylbutyryl-CoA: 71.6
Propionyl-CoA: 71.5
CHC-CoA: 67.5
Acetyl-CoA: 48.8
fatty_acid: 44.6
3-Methylbutyryl-CoA: 43.7
inactive: 29.0

ctg6_175: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (513..897): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg6_178: mmal - mal

PKS_AT (550..850): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.8
Ethylmalonyl-CoA: 210.4
Methoxymalonyl-CoA: 168.4
2-Methylbutyryl-CoA: 151.8
trans-1,2-CPDA: 124.8
Propionyl-CoA: 108.4
Malonyl-CoA: 102.0
CHC-CoA: 98.8
Isobutyryl-CoA: 85.1
Benzoyl-CoA: 72.8
Acetyl-CoA: 48.1
3-Methylbutyryl-CoA: 28.4
inactive: 27.6
fatty_acid: 20.8

PKS_AT (2246..2536): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 66.7%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.1
Methylmalonyl-CoA: 77.2
Methoxymalonyl-CoA: 72.8
inactive: 72.7
Isobutyryl-CoA: 53.3
Propionyl-CoA: 43.6
Ethylmalonyl-CoA: 33.1
CHC-CoA: 32.8
2-Methylbutyryl-CoA: 18.4
Acetyl-CoA: 15.9
Benzoyl-CoA: 11.7
trans-1,2-CPDA: 11.4
fatty_acid: 11.2
3-Methylbutyryl-CoA: 10.8

Link to PARAS substrate predictor

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000006.1 - Region 3 - crocagin

Download region GenBank file

Download region SVG

Location: 329,827 - 357,798 nt. (total: 27,972 nt) Show pHMM detection rules used

crocagin: (PhyH and Carbam_trans_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase reductase

ctg6_235: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

ctg6_246: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase

ctg6_227: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase hydrolase peptidase

ctg6_229: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

ctg6_242: putative esterase

smcogs: SMCOG1104: putative esterase

ctg6_244: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.48	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002659.2	0.45	ribosomal	TvgA-RiPP	Halomonas anticariensis FP35 = DSM 16096
BGC0000657.5	0.43	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000188.5	0.42	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001903.3	0.42	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000877.5	0.39	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0000627.4	0.39	ribosomal	ustiloxin B	Aspergillus flavus NRRL3357
BGC0001540.5	0.39	other (other)	CC-1065	Streptomyces zelensis
BGC0001333.5	0.38	other (other)	BE-54017	uncultured bacterium AB1650

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001488.3	0.48	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002659.2	0.45	ribosomal	TvgA-RiPP	Halomonas anticariensis FP35 = DSM 16096
BGC0000657.5	0.43	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000188.5	0.42	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001903.3	0.42	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000877.5	0.39	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0000627.4	0.39	ribosomal	ustiloxin B	Aspergillus flavus NRRL3357
BGC0001540.5	0.39	other (other)	CC-1065	Streptomyces zelensis
BGC0001333.5	0.38	other (other)	BE-54017	uncultured bacterium AB1650

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

Additional weak hits (7):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.62 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.41 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.97 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.23 out of 26.85

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

JOFL01000006.1 - Region 4 - butyrolactone

Download region GenBank file

Download region SVG

Location: 380,735 - 391,910 nt. (total: 11,176 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg6_275: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

ctg6_280: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.64	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000231.5	0.39	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000667.3	0.37	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0002138.2	0.35	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0000234.5	0.34	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000509.4	0.34	ribosomal	epilancin 15x	Staphylococcus epidermidis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.64	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000231.5	0.39	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000667.3	0.37	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0002138.2	0.35	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0000234.5	0.34	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000509.4	0.34	ribosomal	epilancin 15x	Staphylococcus epidermidis

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.56 out of 29.51

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

JOFL01000006.1 - Region 5 - T1PKS

Download region GenBank file

Download region SVG

Location: 422,039 - 467,333 nt. (total: 45,295 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg6_320: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

ctg6_341: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

ctg6_344: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acylase kinase

ctg6_321: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

ctg6_338: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: amidase

ctg6_354: amidase

smcogs: SMCOG1105: amidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.26 out of 26.85

Confidence: medium

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 25.75

Confidence: strong

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.46 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.42 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.21 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 422038 - 467333:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg6_338: mmal

PKS_AT (543..839): mmal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 123.6
Methoxymalonyl-CoA: 99.8
Ethylmalonyl-CoA: 86.6
2-Methylbutyryl-CoA: 64.0
Isobutyryl-CoA: 63.7
Malonyl-CoA: 60.2
Propionyl-CoA: 59.0
trans-1,2-CPDA: 54.3
Acetyl-CoA: 51.5
fatty_acid: 38.9
Benzoyl-CoA: 34.5
3-Methylbutyryl-CoA: 26.7
CHC-CoA: 24.5
inactive: 18.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MatP	Cell cycle regulator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000006.1 - Region 6 - lanthipeptide-class-i,terpene

Download region GenBank file

Download region SVG

Location: 467,923 - 494,263 nt. (total: 26,341 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase synthase

ctg6_362: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

ctg6_382: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: methyltransferase

ctg6_376: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: synthase

ctg6_382: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: cyclase dehydratase

ctg6_373: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

ctg6_374: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

ctg6_375: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.92	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000657.5	0.66	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.58	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.55	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001289.5	0.43	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.43	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.38	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.38	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.36	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.31	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000657.5	0.66	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001289.5	0.54	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.54	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.51	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.51	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.50	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.46	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

ctg6_375: T1TS

Domain 1 (73 - 406): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.49 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.18 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.33 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.75 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.05 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.73 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.71 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.89 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 171 - 260; Score: 55.0

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000006.1 - Region 7 - phosphonate

Download region GenBank file

Download region SVG

Location: 496,244 - 519,716 nt. (total: 23,473 nt) Show pHMM detection rules used

phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase phosphate reductase

ctg6_394: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

ctg6_398: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

ctg6_399: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: transketolase

ctg6_392: transketolase

smcogs: SMCOG1204: transketolase

Ligases: ligase synthase

ctg6_393: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

ctg6_395: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg6_397: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.45 out of 25.88

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.65 out of 32.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.88 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator

JOFL01000006.1 - Region 8 - T1PKS

Download region GenBank file

Download region SVG

Location: 583,312 - 633,816 nt. (total: 50,505 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg6_456: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

ctg6_463: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

ctg6_464: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg6_465: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.34 out of 29.51

Confidence: medium

Additional weak hits (9):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.62 out of 20.01

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.72 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.68 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.69 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 583311 - 633816:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - Me-ohmal - ohmal - ohmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg6_464: mal - mal - mmal - mal - mal - mal

PKS_AT (606..908): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.6
inactive: 87.9
Methoxymalonyl-CoA: 51.4
Methylmalonyl-CoA: 45.3
Propionyl-CoA: 25.3
Acetyl-CoA: 24.4
Benzoyl-CoA: 19.9
Isobutyryl-CoA: 15.2
Ethylmalonyl-CoA: 14.0
CHC-CoA: 9.2
2-Methylbutyryl-CoA: 8.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2376..2675): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.6
inactive: 81.9
Methoxymalonyl-CoA: 71.1
Methylmalonyl-CoA: 57.3
Propionyl-CoA: 31.9
Isobutyryl-CoA: 26.1
Acetyl-CoA: 21.0
Ethylmalonyl-CoA: 20.1
CHC-CoA: 18.5
Benzoyl-CoA: 17.7
2-Methylbutyryl-CoA: 15.6
trans-1,2-CPDA: 10.0
fatty_acid: 8.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (3912..4211): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.0
Ethylmalonyl-CoA: 205.7
Methoxymalonyl-CoA: 166.5
trans-1,2-CPDA: 143.2
2-Methylbutyryl-CoA: 136.1
Propionyl-CoA: 111.0
CHC-CoA: 103.9
Malonyl-CoA: 101.5
Isobutyryl-CoA: 77.4
Benzoyl-CoA: 64.5
Acetyl-CoA: 45.0
fatty_acid: 42.1
3-Methylbutyryl-CoA: 37.4
inactive: 25.4

PKS_AT (5451..5751): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.8
inactive: 104.6
Methoxymalonyl-CoA: 74.7
Methylmalonyl-CoA: 62.0
Propionyl-CoA: 31.8
Isobutyryl-CoA: 26.4
Ethylmalonyl-CoA: 26.0
Acetyl-CoA: 19.1
fatty_acid: 17.7
2-Methylbutyryl-CoA: 16.0
Benzoyl-CoA: 12.8
trans-1,2-CPDA: 10.9
CHC-CoA: 8.7
3-Methylbutyryl-CoA: 4.5

PKS_AT (6977..7264): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 236.1
inactive: 111.8
Methoxymalonyl-CoA: 67.5
Methylmalonyl-CoA: 65.4
Propionyl-CoA: 36.1
Isobutyryl-CoA: 29.2
Acetyl-CoA: 27.5
Benzoyl-CoA: 26.3
Ethylmalonyl-CoA: 22.5
2-Methylbutyryl-CoA: 14.9
CHC-CoA: 10.5
fatty_acid: 10.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8486..8774): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 237.6
inactive: 118.5
Methoxymalonyl-CoA: 69.5
Methylmalonyl-CoA: 63.2
Propionyl-CoA: 35.7
Isobutyryl-CoA: 35.5
Ethylmalonyl-CoA: 30.0
Benzoyl-CoA: 20.5
Acetyl-CoA: 16.5
2-Methylbutyryl-CoA: 15.9
CHC-CoA: 14.7
fatty_acid: 12.7
trans-1,2-CPDA: 8.6
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000007.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 82,219 - 154,740 nt. (total: 72,522 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg7_103: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg7_105: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg7_109: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg7_66: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

ctg7_72: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg7_74: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

ctg7_81: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg7_84: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg7_86: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg7_87: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

ctg7_94: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase transferase

ctg7_102: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg7_79: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg7_83: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg7_89: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: cyclase dehydratase

ctg7_101: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

ctg7_77: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg7_90: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg7_96: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

ctg7_76: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg7_98: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

ctg7_99: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000222.5	0.90	PKS	FD-594	Streptomyces sp. TA-0256
BGC0000275.4	0.64	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000278.3	0.64	PKS	urdamycin	Streptomyces fradiae
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000234.5	0.60	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000222.5	0.90	PKS	FD-594	Streptomyces sp. TA-0256
BGC0000275.4	0.64	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000278.3	0.64	PKS	urdamycin	Streptomyces fradiae
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000234.5	0.60	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.71 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.61 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.02 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.94 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.44 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.61 out of 35.63

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.47 out of 32.38

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

ctg7_102: mal

PKS_AT (83..362): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 42.3
Methylmalonyl-CoA: 30.6
Methoxymalonyl-CoA: 30.0
inactive: 26.4
fatty_acid: 17.6
Isobutyryl-CoA: 13.1
Propionyl-CoA: 11.8
2-Methylbutyryl-CoA: 9.1
Ethylmalonyl-CoA: 8.1
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 82218 to 154740
Starter unit(s):: butyryl-CoA (Score: 1148.0; E-value: 0)
Malonyl elongations:: 11|12 (Score: 684.0; E-value: 1.3e-208)
Product class(es):: pentangular polyphenol
Product molecular weight(s):: butyryl-CoA_11: 882 Da
butyryl-CoA_12: 924 Da

ctg7_100: CYC C5-C18 (Score: 223.3; E-value: 1.8e-69)
ctg7_101: CYC C4-C21/C2-C23|C2-C19 (Score: 170.9; E-value: 1.4e-53)
ctg7_102: AT (Score: 411.2; E-value: 7.2e-126); AT BAJ52678.1_FD-594_butyryl-CoA (Score: 512.0; E-value: 0.0)
ctg7_107: MET (Score: 46.3; E-value: 6.8e-15)
ctg7_109: KR (Score: 109.2; E-value: 6.3e-34)
ctg7_72: KR C11 (Score: 412.3; E-value: 1.4e-126)
ctg7_75: ACP (Score: 75.2; E-value: 7.2e-24)
ctg7_76: KSIII (Score: 422.4; E-value: 2.9e-129); KSIII BAJ52704.1_FD-594_butyryl-CoA (Score: 636.0; E-value: 0.0)
ctg7_79: GT (Score: 405.7; E-value: 6.3e-124)
ctg7_81: OXY (Score: 245.9; E-value: 2.1e-75)
ctg7_83: GT (Score: 286.7; E-value: 8.4e-88)
ctg7_86: OXY (Score: 308.3; E-value: 2.5e-94)
ctg7_94: KR C19 (Score: 430.6; E-value: 4.2e-132)
ctg7_96: CYC C9-C14 (Score: 242.7; E-value: 2.7e-75)
ctg7_97: ACP (Score: 113.0; E-value: 1.2e-35)
ctg7_98: CLF 11|12 (Score: 684.0; E-value: 1.3e-208)
ctg7_99: KS (Score: 729.1; E-value: 3.2e-222)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000009.1 - Region 1 - melanin

Download region GenBank file

Download region SVG

Location: 74,995 - 85,393 nt. (total: 10,399 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.35	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002596.2	0.34	PKS	lecanoric acid, orsellinic acid	Claviceps purpurea 20.1
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.57	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.35	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002596.2	0.34	PKS	lecanoric acid, orsellinic acid	Claviceps purpurea 20.1
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (5):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.06 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.23 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.35 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

JOFL01000010.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 100,604 - 111,002 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

ctg10_91: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

ctg10_94: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.59 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.35 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.72 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.82 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.86 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.46 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.82 out of 32.93

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

JOFL01000013.1 - Region 1 - T3PKS,terpene

Download region GenBank file

Download region SVG

Location: 79,599 - 129,859 nt. (total: 50,261 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg13_86: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg13_97: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: PPTase

ctg13_75: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

ctg13_73: thioesterase

smcogs: SMCOG1004: thioesterase

ctg13_82: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

ctg13_92: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

ctg13_114: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

ctg13_102: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

ctg13_87: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.56	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.40	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.34	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.27	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002099.3	0.24	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.24	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0000016.4	0.23	other (other)	amphotericin B	Streptomyces nodosus
BGC0000313.4	0.22	NRPS	beauvericin	Beauveria bassiana
BGC0000334.4	0.19	NRPS	cyclosporin A	Tolypocladium inflatum NRRL 8044
BGC0001905.4	0.18	PKS	violapyrone B	Streptomyces somaliensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.82	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0000016.4	0.57	other (other)	amphotericin B	Streptomyces nodosus
BGC0001905.4	0.50	PKS	violapyrone B	Streptomyces somaliensis
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg13_114: T1TS

Domain 1 (7 - 330): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.83 out of 23.43

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.50 out of 23.43

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.90 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

Additional weak hits (19):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.86 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.82 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.88 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.41 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.82 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.94 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.38 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.22 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.95 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.62 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.18 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.32 out of 20.01

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.64 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.84 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

JOFL01000014.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 38,230 - 59,279 nt. (total: 21,050 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase kinase sulfhydrylase

ctg14_46: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

ctg14_56: aminotransferase

smcogs: SMCOG1019: aminotransferase

ctg14_59: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Lyases: cyclase

ctg14_52: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

ctg14_44: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000783.3	0.41	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001896.4	0.41	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001660.3	0.41	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000783.3	0.41	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001896.4	0.41	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001660.3	0.41	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg14_52: T1TS

Domain 1 (10 - 322): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.49 out of 20.01

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (8):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.79 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.91 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.61 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.94 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.99 out of 36.53

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.75 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CatR	H2O2-responsive repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000015.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 22,032 nt. (total: 22,032 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg15_8: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: decarboxylase

ctg15_7: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

ctg15_15: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.77	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.70	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001870.3	0.52	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001498.5	0.50	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002681.3	0.50	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0002682.2	0.50	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.77	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.70	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001870.3	0.52	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001498.5	0.50	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002681.3	0.50	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0002682.2	0.50	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (1):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.63 out of 28.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

JOFL01000016.1 - Region 1 - NAPAA,terpene

Download region GenBank file

Download region SVG

Location: 1 - 47,257 nt. (total: 47,257 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg16_13: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

ctg16_32: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

ctg16_34: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg16_6: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acetyltransferase transferase

ctg16_14: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

ctg16_33: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: dehydratase hydratase

ctg16_16: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg16_20: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

ctg16_35: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthetase

ctg16_26: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg16_5: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.48	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000663.5	0.36	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000777.3	0.30	saccharide	lipopolysaccharide	Escherichia coli
BGC0000916.5	0.28	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000786.3	0.28	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0001135.5	0.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.27	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000880.4	0.27	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0001458.4	0.27	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002553.2	0.27	other (other)	tunicamycin	Rathayibacter iranicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

ctg16_4: T2TS

Domain 1 (32 - 667): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

ctg16_5: PT_FPPS_like

Domain 1 (60 - 352): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

ctg16_7: PT_phytoene_like

Domain 1 (13 - 296): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

ctg16_8: PT_phytoene_like

Domain 1 (16 - 278): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 23.43

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

Additional weak hits (13):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.93 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.12 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.67 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.82 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.36 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.48 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.56 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.73 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 47257:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 13222 - 47257:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg16_26: X

AMP-binding (34..411): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAESIGTVVK
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (68% 8Å match); Gln or Tyr DAESVGTVVK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000016.1 - Region 2 - NRPS-like,T1PKS,prodigiosin

Download region GenBank file

Download region SVG

Location: 51,646 - 103,505 nt. (total: 51,860 nt) Show pHMM detection rules used

prodigiosin: (PPDK_N and AMP-binding and PP-binding and PKS_KS)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg16_51: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acylase methyltransferase

ctg16_55: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

ctg16_63: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg16_66: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

ctg16_65: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

ctg16_64: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

ctg16_50: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg16_57: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg16_59: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg16_61: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

ctg16_62: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

ctg16_46: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000091.5	1.44	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0001063.5	1.18	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0001160.5	1.11	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.10	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002090.3	1.07	NRPS, PKS	undecylprodigiosin, metacycloprodigiosin	Streptomyces griseoaurantiacus
BGC0001833.4	0.94	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.93	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.93	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.92	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001273.3	0.92	PKS	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000091.5	0.78	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0001063.5	0.72	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.69	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002090.3	0.69	NRPS, PKS	undecylprodigiosin, metacycloprodigiosin	Streptomyces griseoaurantiacus
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (13):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.12 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.13 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.72 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.95 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.86 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.56 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.30 out of 26.85

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 51645 - 103505:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg16_62: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (22..429): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLFYLALVCK
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg16_63: NH2 - mal

CAL_domain (53..503): NH2

minowa: NH2

Prediction, score:

NH2: 121.0
fatty_acid: 40.5
AHBA: 16.9
shikimic_acid: 4.9
Acetyl-CoA: 0.2

PKS_AT (1406..1705): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 136.0
inactive: 71.3
Methoxymalonyl-CoA: 56.8
Methylmalonyl-CoA: 50.8
Propionyl-CoA: 31.7
2-Methylbutyryl-CoA: 30.3
trans-1,2-CPDA: 18.3
Ethylmalonyl-CoA: 17.2
CHC-CoA: 16.8
Benzoyl-CoA: 16.5
Isobutyryl-CoA: 12.8
fatty_acid: 8.5
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000016.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 109,719 - 120,186 nt. (total: 10,468 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0000698.5		0.22	saccharide	hygromycin A	Streptomyces hygroscopicus

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000698.5		0.22	saccharide	hygromycin A	Streptomyces hygroscopicus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.14 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (4):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.11 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.36 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.76 out of 26.85

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator

JOFL01000016.1 - Region 4 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 152,698 - 201,491 nt. (total: 48,794 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg16_127: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg16_140: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg16_147: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg16_148: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg16_150: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

ctg16_154: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: PPTase acetyltransferase aminotransferase methyltransferase

ctg16_120: methyltransferase

smcogs: SMCOG1089: methyltransferase

ctg16_123: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

ctg16_125: aminotransferase

smcogs: SMCOG1019: aminotransferase

ctg16_130: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

ctg16_134: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: deacetylase hydrolase

ctg16_137: isochorismatase

smcogs: SMCOG1027: isochorismatase

ctg16_142: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

ctg16_144: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

ctg16_131: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Isomerases: isomerase

ctg16_139: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

ctg16_135: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg16_138: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg16_145: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

ctg16_126: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.84	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.79	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.79	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.70	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.72	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.71	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000401.5	0.68	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.51 out of 26.85

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.62 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.39 out of 24.78

Confidence: medium

Additional weak hits (18):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.15 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.80 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.20 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.47 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.83 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.25 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.25 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.96 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.53 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.16 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.33 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.39 out of 24.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.79 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 152697 - 201491:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg16_135: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (491..890): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg16_138: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (33..446): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: PLPGLGVVNK
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg16_145: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (14..422): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLFYAALVCK
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
LexA variant 2	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism

JOFL01000016.1 - Region 5 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 269,193 - 292,429 nt. (total: 23,237 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

ctg16_231: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001579.4	0.78	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002346.3	0.76	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001660.3	0.70	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.65	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000563.4	0.60	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.59	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000528.5	0.57	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001576.3	0.53	ribosomal	divamide A	Prochloron didemni
BGC0001364.3	0.52	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001779.5	0.49	ribosomal	siamycin	Streptomyces nodosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001579.4	0.78	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002346.3	0.76	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001660.3	0.70	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.65	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000563.4	0.60	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.59	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000528.5	0.57	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001576.3	0.53	ribosomal	divamide A	Prochloron didemni
BGC0001364.3	0.52	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001779.5	0.49	ribosomal	siamycin	Streptomyces nodosus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg16_231

ctg16_232

Leader:

MTATMLRQTVVDAEFRAAVLADPAAFGLSATSLPAA

Core:

VEDFDQESLDFWTEGAVAMNAVECTSSCSSGRFTIICDGGTK

Core with dehydrations:

VEDFDQEDhaLDFWDhbEGAVAMNAVECysDhbDhaDhaCysDhaDhaGRFDhbIICysDGGDhbK

antiSMASH-DB 4.0 matches for ctg16_232

54.8%

NZ_JANBBD010000039.1:

Lanthipeptides: BS35_RS35910_lanthipeptide

1

VEDFDQESLDFWTEGAVAMNAVECTSSCSSGRFTIICDGGTK

42

V D SL +WTEG A++A C S+CSSG FT CDG TK

1

VAQPDTASLGYWTEGVAAVDAYACASTCSSGPFTFACDGSTK

42

52.3%

NZ_JADG01000011.1:

Lanthipeptides: P696_RS0120030_lanthipeptide

1

VEDFDQESLDFWTEGAVAMNAVECTSSCSSGRFTIICDGGTK

42

VE D E L +WTEG A++ C+S+CS G FTI+CDG TK

1

VEQPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTK

42

50.0%

NZ_FUWS01000010.1:

Lanthipeptides: B5D66_RS17810_lanthipeptide

1

VEDFDQESLDFWTEGAVAMNAVECTSSCSSGRFTIICDGGTK

42

VE D E+++ +TE VA C S+CS G FTI CDG TK

1

VERQDHEAIEAFTEAVVASEIYACASTCSFGPFTIACDGTTK

42

with 8 more sequence matches

40.0%

NZ_BMRD01000003.1:

Lanthipeptides: IEZ14_RS08160_lanthipeptide

5

DQESLDFWTEGAVAMNAVECTSSCSSGRFTIICDGGTK

42

D SL +WTEG A++A C S+CSSG FT CDG TK

18

DTASLGYWTEGVAAVDAYACASTCSSGPFTFACDGSTK

55

33.3%

NZ_JAPFGB010000043.1:

Lanthipeptides: OOZ19_RS28825_lanthipeptide

24

CTSSCSSGRFTIICDGGTK

42

C S+CSSG FTI+CDG TK

1

CASTCSSGPFTILCDGSTK

19

28.6%

NZ_CP073318.1:

Lanthipeptides: JJ691_RS07165_lanthipeptide

24

CTSSCSSGRFTIICDGGTK

42

C SCS G FT +CDG TK

1

CVQSCSWGPFTAVCDGNTK

19

26.2%

NZ_CP059557.1:

Lanthipeptides: H2Q94_RS19875_lanthipeptide

24

CTSSCSSGRFTIICDGGTK

42

C SCS G T +CDG TK

1

CVQSCSWGPVTAVCDGNTK

19

21.4%

NZ_CKMQ01000043.1and 10 others:

NZ_CKMQ01000043.1 Lanthipeptides: AE832_RS11585_lanthipeptideNZ_CKMR01000002.1 Lanthipeptides: AD782_RS11690_lanthipeptideNZ_CKMR01000002.1 Lanthipeptides: AD782_RS11690_lanthipeptideNZ_FIXU01000003.1 Lanthipeptides: A1M11_RS11670_lanthipeptideNZ_FIXU01000003.1 Lanthipeptides: A1M11_RS11670_lanthipeptideNZ_LR216041.1 Lanthipeptides: E0F00_RS05465_lanthipeptideNZ_LR216046.1 Lanthipeptides: E0E82_RS05980_lanthipeptideNZ_LR216046.1 Lanthipeptides: E0E82_RS05980_lanthipeptideNZ_PNGD01000001.1 Lanthipeptides: CJ239_RS00170_lanthipeptideNZ_PNGD01000001.1 Lanthipeptides: CJ239_RS00170_lanthipeptide

Lanthipeptides: AE832_RS11585_lanthipeptide

3

DFDQESLDFWTEGAVAMNAVECTSSC

28

F E+L +GAV +EC ++C

6

SFISEALG--NKGAVCTGTIECQNNC

29

18.6%

NZ_QORY01000016.1and 1 other:

NZ_QORY01000016.1 Lanthipeptides: DT250_RS18255_lanthipeptide

Lanthipeptides: DT250_RS18255_lanthipeptide

1

VEDFDQESLDFWTEGAVAMNAVECTSSCS

29

+ D D+ S +G + +ECT+ C+

9

IIDIDRMSKILGNKGRICTYTLECTAGCN

37

16.7%

NZ_NTSR01000029.1and 1 other:

NZ_NTSR01000029.1 Lanthipeptides: CN358_RS25180_lanthipeptide

Lanthipeptides: CN358_RS25180_lanthipeptide

3

DFDQESLDFWTEGAVAMNAVECTSSCS

29

D+ + S+ G + VEC +C+

15

DYIKLSIGLGNNGYICTYTVECQKNCN

41

12.8%

NZ_CP041613.2:

Lanthipeptides: allorf_01202582_01202800_lanthipeptide

32

RFTIICDGGT

41

R ++CDGGT

18

RPRLVCDGGT

27

MIBiG 4.0 matches for ctg16_232

28.6%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

24

CTSSCSSGRFTIICDGGTK

42

C SCS G FT +CDG TK

1

CRQSCSFGPFTFVCDGNTK

19

16.7%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

14

EGAVAMNAVECTSSCS

29

+GA VEC SC+

13

KGAYCTLTVECMPSCN

28

9.5%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

33

FTIICDGGTK

42

+ I C G K

4

YNISCRLGNK

13

with 3 more sequence matches

9.5%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

23

ECTSSC

28

+CTS C

32

KCTSRC

37

9.5%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

23

ECTSSC

28

+CTS C

21

KCTSKC

26

7.1%

BGC0001229.4 (SBI_06990)and 1 other:

BGC0002110.3 (QKV49893.1) Lanthipeptide: birimositide

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

23

ECTSSCS

29

EC +C+

33

ECQPNCN

39

allorf_269660_269815

Leader:

MAVPGATGSPDRSRHPEGHAFRAASREPGA

Core:

WEWEGEEEEREDYRRALMPSC

Core with dehydrations:

WEWEGEEEEREDYRRALMPDhaCys

allorf_269840_270058

Leader:

MLRGNPQSAPSTRSVSAGCTLPSEGGFPPLRFGRAGARAPLTGG

Core:

CGMRSSRRAGREQPADTTAISAFMAAVV

Core with dehydrations:

CysGMRDhaDhaRRAGREQPADDhbDhbAIDhaAFMAAVV

antiSMASH-DB 4.0 matches for allorf_269840_270058

25.7%

NZ_CP047935.1:

Lanthipeptides: allorf_0499838_0500005_lanthipeptide

2

GMRSSRRAGREQPADTTAISAFMAAVV

28

GMR+ +PA+T +AF A +

1

GMRNPANDSGNRPANTEHHTAFHATYI

27

21.4%

NZ_CP054018.1and 3 others:

NZ_KV804818.1 Lanthipeptides: allorf_109292_109366_lanthipeptideNZ_KV804818.1 Lanthipeptides: allorf_109292_109366_lanthipeptideNZ_KV820076.1 Lanthipeptides: allorf_134599_134673_lanthipeptide

Lanthipeptides: allorf_0084035_0084109_lanthipeptide

1

CGMRSSRRAG

10

CG+R + RAG

5

CGLRGTCRAG

14

allorf_270090_270167

Leader:

MRQRTIVAA

Core:

QQPCLAVGGRRPARSS

Core with dehydrations:

QQPCysLAVGGRRPARDhaDha

antiSMASH-DB 4.0 matches for allorf_270090_270167

10.2%

NZ_KB907211.1:

Lanthipeptides: G339_RS0112000_lanthipeptide

8

GGRRPARSS

16

GG+ PA+SS

21

GGKEPAKSS

29

9.6%

NZ_CP013219.1:

Lanthipeptides: allorf_0170753_0170935_lanthipeptide

2

QPCLAVGGRRPAR

14

PC ++G RP++

18

HPCRSIGAGRPSK

30

allorf_272375_272506

Leader:

MRGGRDRRDAVRPAPRGPRGDHRRPLVGA

Core:

HRRIVTPCRVHQVR

Core with dehydrations:

HRRIVDhbPCysRVHQVR

allorf_283266_283382

Leader:

MDHPNSVRRPGRTTLDGG

Core:

TCRSVTPGIHGAFALLSTHF

Core with dehydrations:

DhbCysRDhaVDhbPGIHGAFALLDhaDhbHF

allorf_285279_285416

Leader:

MLVMAATLGS

Core:

RRPAALGLPATVYPYESRGRWPTTVVDGRAIACLG

Core with dehydrations:

RRPAALGLPADhbVYPYEDhaRGRWPDhbDhbVVDGRAIACysLG

antiSMASH-DB 4.0 matches for allorf_285279_285416

25.0%

NZ_BNCA01000011.1and 1 other:

NZ_BNCA01000011.1 Lanthipeptides: allorf_144104_144280_lanthipeptide

Lanthipeptides: allorf_144104_144280_lanthipeptide

8

LPATVYPYESRGRWPTTVVDGRAIACLG

35

LPAT YP R R D R + G

5

LPATRYPGVCRARTSRRARDPRKVTTQG

32

20.9%

NZ_CP094446.1:

Lanthipeptides: L3476_RS23825_lanthipeptide

7

GLPATVYPYESRGRWPTTVVDGRAIA

32

G PAT+ +R P G AI+

7

GTPATIVSAVTRSSKPCISAIGSAIS

32

14.3%

NZ_CP095046.1:

Lanthipeptides: allorf_0852532_0852729_lanthipeptide

13

YPYESRGRW

21

+PYE + RW

1

HPYERQNRW

9

with 1 more sequence matches

14.3%

NZ_JACHKG010000014.1:

Lanthipeptides: allorf_016383_016538_lanthipeptide

11

TVYPYESRGRWP

22

TV P+++RG P

9

TVTPFQARGTLP

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.73 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.03 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.13 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.08 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.28 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.44 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.32 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.72 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.43 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

ctg16_232 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 4342.9 Da

Molecular weight: 4345.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4363.7 Da N = 1; 4381.7 Da N = 2; 4399.8 Da N = 3; 4417.8 Da N = 4; 4435.8 Da N = 5; 4453.8 Da N = 6

allorf_269660_269815 - Class II

Cleavage pHMM score: -5.30

RODEO score: 0

Monoisotopic mass: 2681.1 Da

Molecular weight: 2682.8 Da

Number of bridges: 1

allorf_269840_270058 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 2848.4 Da

Molecular weight: 2850.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2868.3 Da N = 1; 2886.3 Da N = 2; 2904.3 Da N = 3; 2922.3 Da N = 4

allorf_270090_270167 - Class II

Cleavage pHMM score: -1.80

RODEO score: 0

Monoisotopic mass: 1645.9 Da

Molecular weight: 1646.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1664.9 Da N = 1

allorf_272375_272506 - Class II

Cleavage pHMM score: -5.50

RODEO score: 0

Monoisotopic mass: 1738.0 Da

Molecular weight: 1739.1 Da

Number of bridges: 1

allorf_283266_283382 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 2024.1 Da

Molecular weight: 2025.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2043.3 Da N = 1; 2061.4 Da N = 2; 2079.4 Da N = 3; 2097.4 Da N = 4

allorf_285279_285416 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 3697.0 Da

Molecular weight: 3699.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3717.3 Da N = 1; 3735.3 Da N = 2; 3753.3 Da N = 3

TFBS definitions

Regulator	Description

JOFL01000017.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 87,498 - 121,643 nt. (total: 34,146 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase glucosidase

ctg17_104: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

ctg17_106: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

ctg17_107: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase

ctg17_100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

ctg17_96: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.72	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.72	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.92 out of 29.65

Confidence: medium

Additional weak hits (9):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.10 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.67 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.06 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.65 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.92 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.46 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.29 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 87497 - 121643:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg17_100: X

AMP-binding (62..456): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFECLSVVTK
Nearest Stachelhaus code(s):: Ile or Val DFLCLGVVIK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
LexA variant 1	Repressor of DNA damage response

JOFL01000020.1 - Region 1 - NRP-metallophore,NRPS,T1PKS,butyrolactone

Download region GenBank file

Download region SVG

Location: 3,490 - 101,698 nt. (total: 98,209 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg20_40: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg20_43: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg20_63: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: PPTase acyltransferase aminotransferase kinase

ctg20_30: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

ctg20_34: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

ctg20_64: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

ctg20_65: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Hydrolases: hydrolase

ctg20_26: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: hydratase

ctg20_44: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

ctg20_23: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg20_38: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg20_41: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg20_59: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transport

ctg20_24: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001752.4	1.10	NRPS	qinichelins	Streptomyces sp. MBT76
BGC0001160.5	1.07	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.06	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.81	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002276.2	0.79	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001268.4	0.78	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001133.4	0.76	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000351.5	0.75	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001752.4	0.79	NRPS	qinichelins	Streptomyces sp. MBT76
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.70	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.62 out of 36.53

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

Additional weak hits (22):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.51 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.96 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.03 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.21 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.90 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.98 out of 29.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.51 out of 29.51

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.01 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.53 out of 31.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.65 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.30 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.62 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.73 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.87 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.48 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.63 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.17 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 3489 - 51073:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 46696 - 101698:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - Orn - D-Ser) + (Ser - OH-Orn - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 52683 - 101698:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - Orn - D-Ser) + (Ser - OH-Orn - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg20_23: pk

PKS_AT (554..848): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 66.7%; CE-Malonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 105.4
Malonyl-CoA: 94.3
Methoxymalonyl-CoA: 94.2
Isobutyryl-CoA: 68.9
Propionyl-CoA: 59.1
Ethylmalonyl-CoA: 51.9
Benzoyl-CoA: 50.7
trans-1,2-CPDA: 39.8
Acetyl-CoA: 37.6
2-Methylbutyryl-CoA: 36.3
fatty_acid: 29.6
CHC-CoA: 28.5
inactive: 25.9
3-Methylbutyryl-CoA: 10.3

ctg20_59: Ser - OH-Orn - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (485..885): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1559..1964): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DMENLGLINK
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2623..3032): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DMENLGLINK
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg20_60: Ser - Orn - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (475..870): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match); Ala or Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2212..2616): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DSEDLGFVDK
Nearest Stachelhaus code(s):: Orn DSEDLGFVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3279..3735): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator

JOFL01000021.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 58,056 - 91,077 nt. (total: 33,022 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg21_51: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

ctg21_62: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

ctg21_48: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.09 out of 27.18

Confidence: medium

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.63 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.60 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.02 out of 24.78

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes

JOFL01000022.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 43,083 - 54,246 nt. (total: 11,164 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg22_46: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

ctg22_52: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.69	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.49	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.42	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001771.4	0.34	NRPS	scleric acid	Streptomyces sclerotialus
BGC0001302.5	0.33	other (other)	lomofungin	Streptomyces lomondensis
BGC0000843.5	0.32	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000934.4	0.32	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0001909.3	0.32	PKS	strobilurin A	Strobilurus tenacellus
BGC0000277.5	0.31	PKS	urdamycin	Streptomyces fradiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.69	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.49	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.42	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001771.4	0.34	NRPS	scleric acid	Streptomyces sclerotialus
BGC0001302.5	0.33	other (other)	lomofungin	Streptomyces lomondensis
BGC0000843.5	0.32	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000934.4	0.32	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0001909.3	0.32	PKS	strobilurin A	Strobilurus tenacellus
BGC0000277.5	0.31	PKS	urdamycin	Streptomyces fradiae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.25 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.82 out of 25.88

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.61 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.23 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.97 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.35 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

JOFL01000022.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 69,781 - 92,316 nt. (total: 22,536 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: synthase

ctg22_71: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Hydrolases: hydrolase synthase

ctg22_71: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

ctg22_81: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: synthase

ctg22_69: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002669.2	0.42	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000277.5	0.40	PKS	urdamycin	Streptomyces fradiae
BGC0002213.3	0.38	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0002295.3	0.36	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0001026.3	0.36	NRPS, PKS	NG-391	Metarhizium anisopliae
BGC0000375.5	0.36	NRPS	indigoidine	Streptomyces chromofuscus
BGC0001336.5	0.35	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000842.5	0.35	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001366.5	0.35	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001954.2	0.35	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002669.2	0.42	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000277.5	0.40	PKS	urdamycin	Streptomyces fradiae
BGC0002213.3	0.38	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0002295.3	0.36	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0001026.3	0.36	NRPS, PKS	NG-391	Metarhizium anisopliae
BGC0000375.5	0.36	NRPS	indigoidine	Streptomyces chromofuscus
BGC0001336.5	0.35	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000842.5	0.35	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001366.5	0.35	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001954.2	0.35	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (14):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.09 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.83 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.73 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.04 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.26 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.37 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.81 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.79 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.34 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.85 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.58 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.97 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 4 - 86; Score: 45.8

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

JOFL01000024.1 - Region 1 - CDPS,NAPAA

Download region GenBank file

Download region SVG

Location: 6,290 - 41,298 nt. (total: 35,009 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)
CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg24_28: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase methyltransferase

ctg24_25: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

ctg24_27: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase

ctg24_24: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.85	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002535.2	0.58	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002135.2	0.56	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.54	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.54	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.54	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.53	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.53	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.53	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.74	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002535.2	0.62	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.70 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.15 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.67 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.25 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.70 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 6289 - 41298:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 6289 - 40381:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 20506 - 41298:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg24_24: X

AMP-binding (37..430): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFECLSAVTK
Nearest Stachelhaus code(s):: Val DFESLAAVYK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000024.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 71,033 - 88,565 nt. (total: 17,533 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg24_75: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg24_94: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Ligases: synthetase

ctg24_93: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.54	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000677.5	0.52	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001224.5	0.42	other (other)	reductasporine	uncultured bacterium
BGC0002103.2	0.41	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0002218.2	0.40	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001911.3	0.40	terpene	raimonol	Streptomyces anulatus
BGC0001223.5	0.39	other (other)	hydroxysporine	uncultured bacterium
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.54	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000677.5	0.52	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001224.5	0.42	other (other)	reductasporine	uncultured bacterium
BGC0002103.2	0.41	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0002218.2	0.40	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001911.3	0.40	terpene	raimonol	Streptomyces anulatus
BGC0001223.5	0.39	other (other)	hydroxysporine	uncultured bacterium
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg24_93: PT_FPPS_like

Domain 1 (88 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (4):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.82 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.99 out of 29.25

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

JOFL01000027.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 18,080 - 39,141 nt. (total: 21,062 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg27_19: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Lyases: cyclase

ctg27_25: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000923.3	0.69	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0001757.3	0.60	other (other)	rhabduscin	Xenorhabdus nematophila ATCC 19061
BGC0002733.3	0.40	other (other)	sinapigladioside	Burkholderia gladioli
BGC0000668.5	0.39	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000903.3	0.37	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001126.4	0.36	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001612.3	0.36	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903
BGC0001501.5	0.36	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001595.3	0.35	other (other)	fischerindole	Fischerella sp. SAG 46.79

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000923.3	0.69	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0001757.3	0.60	other (other)	rhabduscin	Xenorhabdus nematophila ATCC 19061
BGC0002733.3	0.40	other (other)	sinapigladioside	Burkholderia gladioli
BGC0000668.5	0.39	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000903.3	0.37	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001126.4	0.36	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001612.3	0.36	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903
BGC0001501.5	0.36	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001595.3	0.35	other (other)	fischerindole	Fischerella sp. SAG 46.79

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg27_25: T1TS

Domain 1 (12 - 301): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

Additional weak hits (4):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.10 out of 31.73

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.64 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.66 out of 31.73

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

JOFL01000028.1 - Region 1 - T1PKS,other

Download region GenBank file

Download region SVG

Location: 10,530 - 69,975 nt. (total: 59,446 nt) Show pHMM detection rules used

Region on contig edge.

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

ctg28_11: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

ctg28_12: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

ctg28_14: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

ctg28_15: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

ctg28_30: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg28_31: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

ctg28_35: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

ctg28_40: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

ctg28_55: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase aminotransferase glycosyltransferase methyltransferase

ctg28_25: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg28_37: methyltransferase

smcogs: SMCOG1089: methyltransferase

ctg28_42: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg28_53: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg28_54: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg28_60: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

ctg28_34: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

ctg28_36: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

ctg28_29: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg28_38: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

ctg28_57: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.43	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000138.5	0.38	PKS	rimocidin	Streptomyces diastaticus
BGC0000898.5	0.31	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0001273.3	0.30	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.30	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.30	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.30	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.28	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.28	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.28	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (11):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.99 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.01 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.26 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.02 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.85 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.72 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.47 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.60 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.58 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.53 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 10529 - 69975:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (ccmal)
Non-colinear ordering:: ctg28_57 + ctg28_60

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 40077 - 69975:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (ccmal)
Non-colinear ordering:: ctg28_57 + ctg28_60

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg28_29: X

AMP-binding (30..342): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AYGAMGNAVK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg28_57: mal

PKS_AT (558..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 58.3%; Isobutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.4
inactive: 67.7
Methoxymalonyl-CoA: 65.3
Methylmalonyl-CoA: 62.3
Propionyl-CoA: 35.6
Ethylmalonyl-CoA: 27.7
Isobutyryl-CoA: 21.0
fatty_acid: 18.3
Acetyl-CoA: 16.9
Benzoyl-CoA: 16.3
3-Methylbutyryl-CoA: 14.6
2-Methylbutyryl-CoA: 12.8
CHC-CoA: 9.2
trans-1,2-CPDA: 5.9

ctg28_60: mal

PKS_AT (343..634): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 228.5
inactive: 106.8
Methoxymalonyl-CoA: 49.3
Methylmalonyl-CoA: 43.3
Propionyl-CoA: 27.6
Acetyl-CoA: 21.7
Ethylmalonyl-CoA: 18.0
Benzoyl-CoA: 17.3
fatty_acid: 14.3
Isobutyryl-CoA: 11.5
CHC-CoA: 6.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -3.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
ToxT	Regulator of MSHA biosynthesis

JOFL01000033.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 61,197 - 82,096 nt. (total: 20,900 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

ctg33_61: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000590.5	0.40	ribosomal	microcin N	Escherichia coli
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000590.5	0.40	ribosomal	microcin N	Escherichia coli
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 21.55

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (10):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.37 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.26 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.77 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.25 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 32.93

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.13 out of 18.57

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.63 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.77 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.52 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
ArcA	Repressor of carbon oxidation

JOFL01000034.1 - Region 1 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 7,087 - 59,298 nt. (total: 52,212 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg34_38: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

ctg34_43: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: kinase

ctg34_39: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: dehalogenase hydrolase

ctg34_41: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

ctg34_46: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase dehydratase

ctg34_11: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

ctg34_40: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

ctg34_42: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg34_44: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.33	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.33	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.33	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.33	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.30	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.29	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.29	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001268.4	0.28	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002191.2	0.28	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.27	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001268.4	0.62	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg34_11: T1TS

Domain 1 (4 - 318): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 28.19

Confidence: medium

Additional weak hits (19):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.97 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.51 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.70 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.97 out of 27.04

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.76 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.44 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.72 out of 32.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.72 out of 29.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.48 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.57 out of 20.01

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 7086 - 59298:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 28057 - 59298:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg34_42: X

AMP-binding (13..431): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -ALMLFVPVK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg34_43: pk

PKS_AT (523..825): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 120.1
Malonyl-CoA: 114.8
Methoxymalonyl-CoA: 113.1
Ethylmalonyl-CoA: 76.5
Isobutyryl-CoA: 73.9
Propionyl-CoA: 69.8
2-Methylbutyryl-CoA: 60.4
inactive: 44.1
Acetyl-CoA: 43.8
trans-1,2-CPDA: 40.2
fatty_acid: 40.1
CHC-CoA: 35.5
Benzoyl-CoA: 27.8
3-Methylbutyryl-CoA: 21.2

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

JOFL01000035.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 10,297 - 53,797 nt. (total: 43,501 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg35_47: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: hydrolase

ctg35_20: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

ctg35_27: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase lyase

ctg35_29: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

ctg35_32: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg35_45: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002294.3	0.45	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002313.3	0.43	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000503.5	0.43	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000783.3	0.42	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000874.5	0.41	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000197.5	0.41	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0002536.3	0.40	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002294.3	0.45	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002313.3	0.43	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000503.5	0.43	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000783.3	0.42	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000874.5	0.41	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000197.5	0.41	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0002536.3	0.40	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (12):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.22 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.61 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.81 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.61 out of 27.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.94 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.10 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.39 out of 30.22

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.22 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.35 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.49 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 10296 - 53797:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg35_32: X

AMP-binding (32..471): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VNASLGCRPK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator

JOFL01000043.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 2,877 - 19,548 nt. (total: 16,672 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg43_12: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: hydrolase

ctg43_14: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: synthase

ctg43_4: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.73	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.71	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001634.3	0.63	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002298.2	0.62	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0000575.5	0.61	ribosomal	lariatin	Rhodococcus jostii
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.60	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002064.2	0.57	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.73	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.71	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001634.3	0.63	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002298.2	0.62	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0000575.5	0.61	ribosomal	lariatin	Rhodococcus jostii
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.60	ribosomal	ulleungdin	Streptomyces sp.
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002064.2	0.57	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.31 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.55 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.46 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.56 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 84; Score: 67.8

TFBS definitions

Regulator	Description

JOFL01000044.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 19,428 nt. (total: 19,428 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg44_2: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg44_3: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

ctg44_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg44_4: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 19428:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (ccmal - ccmal)
Non-colinear ordering:: ctg44_2 + ctg44_4

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg44_1: mal

PKS_AT (0..164): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 107.3
inactive: 57.8
Methoxymalonyl-CoA: 17.0
Methylmalonyl-CoA: 8.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg44_2: mal

PKS_AT (564..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.2
inactive: 97.6
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 57.7
Propionyl-CoA: 41.0
Isobutyryl-CoA: 39.6
Ethylmalonyl-CoA: 22.6
Acetyl-CoA: 20.9
2-Methylbutyryl-CoA: 16.2
Benzoyl-CoA: 12.8
trans-1,2-CPDA: 7.9
3-Methylbutyryl-CoA: 7.2
CHC-CoA: 3.4
fatty_acid: 0.0

ctg44_4: mal - mal

PKS_AT (1..231): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.0
inactive: 92.7
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 60.3
Propionyl-CoA: 36.5
Acetyl-CoA: 25.1
Isobutyryl-CoA: 22.2
2-Methylbutyryl-CoA: 16.6
Benzoyl-CoA: 14.8
Ethylmalonyl-CoA: 11.4
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1627..1912): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.9
Methylmalonyl-CoA: 82.8
Methoxymalonyl-CoA: 77.1
inactive: 67.5
Ethylmalonyl-CoA: 43.8
Propionyl-CoA: 40.9
Isobutyryl-CoA: 39.1
Acetyl-CoA: 31.5
2-Methylbutyryl-CoA: 28.7
Benzoyl-CoA: 27.4
trans-1,2-CPDA: 19.9
CHC-CoA: 19.0
fatty_acid: 17.1
3-Methylbutyryl-CoA: 6.6

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

JOFL01000046.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 15,366 nt. (total: 15,366 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg46_11: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg46_4: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg46_9: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase

ctg46_14: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: cyclase

ctg46_10: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

ctg46_5: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: ligase synthase

ctg46_2: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg46_6: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg46_7: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.84	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.79	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.78	PKS	oviedomycin	Streptomyces antibioticus
BGC0002477.3	0.62	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0002047.2	0.62	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000235.5	0.61	PKS	kiamycin	Streptomyces sp. W007
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002000.4	0.60	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001596.3	0.60	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.84	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.79	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.78	PKS	oviedomycin	Streptomyces antibioticus
BGC0002477.3	0.62	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0002047.2	0.62	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0000235.5	0.61	PKS	kiamycin	Streptomyces sp. W007
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002000.4	0.60	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001596.3	0.60	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.11 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (6):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.65 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.28 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.63 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.33 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.88 out of 27.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

ctg46_2: X

AMP-binding (32..307): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGLRVA---K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 0 to 15366
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 709.0; E-value: 3.5e-216)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 351 Da
acetyl-CoA_9: 393 Da

ctg46_10: CYC C7-C12 (Score: 507.4; E-value: 2.5e-155)
ctg46_11: KR C15 (Score: 491.5; E-value: 1.1e-150)
ctg46_4: OXY (Score: 612.6; E-value: 1.2e-186)
ctg46_5: CYC C4-C17/C2-C19 (Score: 201.0; E-value: 4e-62)
ctg46_6: KS (Score: 794.0; E-value: 6.5e-242)
ctg46_7: CLF 8|9 (Score: 709.0; E-value: 3.5e-216)
ctg46_8: ACP (Score: 128.9; E-value: 1.3e-40)
ctg46_9: KR C9 (Score: 486.5; E-value: 4e-149)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production

JOFL01000051.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 6,054 nt. (total: 6,054 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg51_1: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6054:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg51_1: mal

PKS_AT (1..188): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 130.7
inactive: 70.0
Methoxymalonyl-CoA: 43.2
Methylmalonyl-CoA: 28.5
Propionyl-CoA: 15.7
Acetyl-CoA: 11.7
Ethylmalonyl-CoA: 9.2
Isobutyryl-CoA: 5.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

JOFL01000057.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 3,522 nt. (total: 3,522 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg57_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg57_1: mal

PKS_AT (337..627): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.2
inactive: 113.7
Methoxymalonyl-CoA: 59.3
Methylmalonyl-CoA: 49.7
Propionyl-CoA: 26.8
Isobutyryl-CoA: 21.4
Acetyl-CoA: 21.4
Benzoyl-CoA: 18.7
Ethylmalonyl-CoA: 18.5
fatty_acid: 15.9
2-Methylbutyryl-CoA: 5.9
CHC-CoA: 2.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor