Umezawaea_tangerina_NRRL_B-24463 - 65 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

KL571727.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	azole-containing-RiPP	32,538	46,533

KL571730.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	NRPS	31,628	76,745

KL571733.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	NRPS	9,604	86,938	Low	surugamide A/surugamide D	NRPS:Type I

KL571735.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	arylpolyene	67,009	108,169

KL571743.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	RiPP-like	62,499	73,314

KL571747.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	T1PKS	1	20,110

KL571761.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	NRPS-like	1	24,861	Low	naphthyridinomycin	NRPS:Type I

KL571766.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 52.1	T3PKS,terpene	1	39,528	Low	kendomycin	PKS:Type I

KL571774.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 61.1	terpene	41,503	71,726	Low	brasilicardin A	terpene+saccharide

KL571788.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 76.1	terpene	37,305	58,264

KL571792.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 80.1	lanthipeptide-class-iii	1	14,830	Medium	Ery-9/Ery-6/Ery-8/Ery-7/Ery-5/Ery-4/Ery-3	ribosomal:RiPP:Lanthipeptide

KL571803.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 91.1	indole	18,526	39,452

KL571809.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 97.1	NRPS-like	1	29,457

KL571811.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 99.1	terpene	1	14,896	High	isorenieratene	terpene

KL571817.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 105.1	NRPS	5,037	37,159	Low	triostin A	NRPS:Type I

KL571829.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 117.1	NRPS	1	37,274

KL571837.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 125.1	T1PKS	1	38,742	Low	lucensomycin	PKS

KL571855.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 144.1	HR-T2PKS,terpene-precursor	1	36,457	Low	atratumycin	NRPS:Type I

KL571859.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 148.1	betalactone	2,958	31,677

KL571862.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 151.1	RRE-containing,RiPP-like	15,541	36,038

KL571869.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 158.1	NRPS-like,phosphonate	1	23,603

KL571874.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 163.1	terpene-precursor	1	10,984

KL571877.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 168.1	NRPS	24,818	67,499	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I

KL571879.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 170.1	NRPS-like,terpene	1	32,083

KL571880.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 171.1	terpene	5,387	42,555	Medium	xiamycin/indosespene/sespenine/dixiamycin A/dixiamycin B/sulfadixiamycin A/sulfadixiamycin B/sulfadixiamycin C	terpene:Sesquiterpene+other:other

KL571882.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 173.1	NRPS	20,365	59,386	Low	azetidomonamide A/azetidomonamide B	NRPS:Type I

KL571905.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 196.1	NRP-metallophore,NRPS,NRPS-like	1	48,944	Low	peucechelin	NRPS:Type I

KL571910.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 201.1	T1PKS	1	25,579	Low	tautomycetin	PKS:Type I

KL571911.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 202.1	azoxy-crosslink	11,480	30,699

KL571916.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 207.1	NAPAA	1	22,787	High	ε-Poly-L-lysine	NRPS:Type I

KL571920.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 211.1	terpene-precursor	24,533	35,818

KL571925.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 216.1	T1PKS,hglE-KS	1	35,618

KL571927.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 218.1	lassopeptide	1	19,550	Low	humidimycin	ribosomal:RiPP

KL571936.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 227.1	NRPS-like,T1PKS,T3PKS	1	43,472

KL571958.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 251.1	T1PKS	1	25,094	Low	polyoxypeptin	NRPS:Type I+PKS

KL571974.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 267.1	terpene-precursor	4,043	19,579	Low	isorenieratene	terpene

KL571979.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 272.1	lanthipeptide-class-ii	11,085	28,237

KL571999.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 294.1	terpene	1	19,138

KL572014.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 310.1	NRPS,NRPS-like	1	21,213	Low	naphthyridinomycin	NRPS:Type I

KL572019.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 315.1	T1PKS	1	14,367	Low	iminimycin A/iminimycin B	PKS+other:other

KL572025.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 321.1	T1PKS	1	12,714

KL572071.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 370.1	T1PKS	1	4,293	Low	terpenomycin	PKS:Modular type I

KL572074.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 373.1	NRPS-like,NRPS,PKS-like	1	36,196

KL572076.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 375.1	T1PKS	1	24,342	Low	elaiophylin	PKS

KL572084.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 384.1	ectoine	1	7,062	Low	showdomycin	other:other

KL572094.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 396.1	T1PKS	1	10,885	Low	lasalocid	PKS

KL572115.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 422.1	T1PKS	1	3,316

KL572116.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 423.1	terpene	1	6,276

KL572123.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 434.1	T1PKS	1	15,118	Medium	spirangien O	PKS:Type I

KL572132.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 445.1	T1PKS	1	7,980	Low	mediomycin A	PKS

KL572134.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 447.1	T1PKS	1	6,836	Low	lasalocid	PKS

KL572139.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 452.1	NRPS	1	7,430

KL572152.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 465.1	T1PKS	1	3,733

KL572160.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 473.1	T1PKS	1	7,634	Medium	geldanamycin	PKS

KL572161.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 474.1	T1PKS	1	5,102

KL572165.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 478.1	T1PKS	1	22,994	Low	niphimycin C/niphimycin D/niphimycin E/17-O-methylniphimycin/niphimycin Iα/19-O-malonylniphimycin	PKS

KL572166.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 479.1	T1PKS	1	4,242

KL572172.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 488.1	T1PKS	1	5,337	Low	tetrafibricin	PKS+other:other

KL572176.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 492.1	T1PKS	1	3,458

KL572178.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 495.1	T1PKS	1	3,406	Low	mediomycin A	PKS+other:other

KL572183.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 500.1	T1PKS	1	6,599	Low	alchivemycin A/alchivemycin B	PKS+NRPS:Type I

JNYU01004171.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 516.1	T1PKS	1	1,325

KL572199.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 523.1	T1PKS	1	8,424	Low	mediomycin A	PKS

KL572209.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 535.1	T1PKS	1	1,386

KL572212.1 (Umezawaea tangerina)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 538.1	T1PKS	1	2,751

No secondary metabolite regions were found in these records:: KL571717.1 (Umezawaea tangerina); KL571718.1 (Umezawaea tangerina); KL571719.1 (Umezawaea tangerina); KL571720.1 (Umezawaea tangerina); KL571721.1 (Umezawaea tangerina); KL571722.1 (Umezawaea tangerina); KL571723.1 (Umezawaea tangerina); KL571724.1 (Umezawaea tangerina); KL571725.1 (Umezawaea tangerina); KL571726.1 (Umezawaea tangerina); KL571728.1 (Umezawaea tangerina); KL571729.1 (Umezawaea tangerina); KL571731.1 (Umezawaea tangerina); KL571732.1 (Umezawaea tangerina); KL571734.1 (Umezawaea tangerina); KL571736.1 (Umezawaea tangerina); KL571737.1 (Umezawaea tangerina); KL571738.1 (Umezawaea tangerina); KL571739.1 (Umezawaea tangerina); KL571740.1 (Umezawaea tangerina); KL571741.1 (Umezawaea tangerina); KL571742.1 (Umezawaea tangerina); JNYU01000424.1 (Umezawaea tangerina); KL571744.1 (Umezawaea tangerina); KL571745.1 (Umezawaea tangerina); KL571746.1 (Umezawaea tangerina); KL571748.1 (Umezawaea tangerina); KL571749.1 (Umezawaea tangerina); KL571750.1 (Umezawaea tangerina); KL571751.1 (Umezawaea tangerina); KL571752.1 (Umezawaea tangerina); KL571753.1 (Umezawaea tangerina); KL571754.1 (Umezawaea tangerina); KL571755.1 (Umezawaea tangerina); KL571756.1 (Umezawaea tangerina); KL571757.1 (Umezawaea tangerina); KL571758.1 (Umezawaea tangerina); KL571759.1 (Umezawaea tangerina); KL571760.1 (Umezawaea tangerina); KL571762.1 (Umezawaea tangerina); JNYU01000653.1 (Umezawaea tangerina); KL571763.1 (Umezawaea tangerina); KL571764.1 (Umezawaea tangerina); KL571765.1 (Umezawaea tangerina); KL571767.1 (Umezawaea tangerina); KL571768.1 (Umezawaea tangerina); KL571769.1 (Umezawaea tangerina); KL571770.1 (Umezawaea tangerina); JNYU01000788.1 (Umezawaea tangerina); KL571771.1 (Umezawaea tangerina); KL571772.1 (Umezawaea tangerina); KL571773.1 (Umezawaea tangerina); JNYU01000859.1 (Umezawaea tangerina); KL571775.1 (Umezawaea tangerina); KL571776.1 (Umezawaea tangerina); KL571777.1 (Umezawaea tangerina); KL571778.1 (Umezawaea tangerina); KL571779.1 (Umezawaea tangerina); KL571780.1 (Umezawaea tangerina); KL571781.1 (Umezawaea tangerina); KL571782.1 (Umezawaea tangerina); KL571783.1 (Umezawaea tangerina); KL571784.1 (Umezawaea tangerina); KL571785.1 (Umezawaea tangerina); KL571786.1 (Umezawaea tangerina); KL571787.1 (Umezawaea tangerina); KL571789.1 (Umezawaea tangerina); KL571790.1 (Umezawaea tangerina); KL571791.1 (Umezawaea tangerina); KL571793.1 (Umezawaea tangerina); KL571794.1 (Umezawaea tangerina); KL571795.1 (Umezawaea tangerina); KL571796.1 (Umezawaea tangerina); KL571797.1 (Umezawaea tangerina); KL571798.1 (Umezawaea tangerina); KL571799.1 (Umezawaea tangerina); KL571800.1 (Umezawaea tangerina); KL571801.1 (Umezawaea tangerina); KL571802.1 (Umezawaea tangerina); KL571804.1 (Umezawaea tangerina); KL571805.1 (Umezawaea tangerina); KL571806.1 (Umezawaea tangerina); KL571807.1 (Umezawaea tangerina); KL571808.1 (Umezawaea tangerina); KL571810.1 (Umezawaea tangerina); KL571812.1 (Umezawaea tangerina); KL571813.1 (Umezawaea tangerina); KL571814.1 (Umezawaea tangerina); KL571815.1 (Umezawaea tangerina); KL571816.1 (Umezawaea tangerina); KL571818.1 (Umezawaea tangerina); KL571819.1 (Umezawaea tangerina); KL571820.1 (Umezawaea tangerina); KL571821.1 (Umezawaea tangerina); KL571822.1 (Umezawaea tangerina); KL571823.1 (Umezawaea tangerina); KL571824.1 (Umezawaea tangerina); KL571825.1 (Umezawaea tangerina); KL571826.1 (Umezawaea tangerina); KL571827.1 (Umezawaea tangerina); KL571828.1 (Umezawaea tangerina); KL571830.1 (Umezawaea tangerina); KL571831.1 (Umezawaea tangerina); KL571832.1 (Umezawaea tangerina); KL571833.1 (Umezawaea tangerina); KL571834.1 (Umezawaea tangerina); KL571835.1 (Umezawaea tangerina); KL571836.1 (Umezawaea tangerina); KL571838.1 (Umezawaea tangerina); KL571839.1 (Umezawaea tangerina); KL571840.1 (Umezawaea tangerina); JNYU01001580.1 (Umezawaea tangerina); KL571841.1 (Umezawaea tangerina); KL571842.1 (Umezawaea tangerina); KL571843.1 (Umezawaea tangerina); KL571844.1 (Umezawaea tangerina); KL571845.1 (Umezawaea tangerina); KL571846.1 (Umezawaea tangerina); KL571847.1 (Umezawaea tangerina); KL571848.1 (Umezawaea tangerina); KL571849.1 (Umezawaea tangerina); KL571850.1 (Umezawaea tangerina); KL571851.1 (Umezawaea tangerina); KL571852.1 (Umezawaea tangerina); KL571853.1 (Umezawaea tangerina); KL571854.1 (Umezawaea tangerina); KL571856.1 (Umezawaea tangerina); KL571857.1 (Umezawaea tangerina); KL571858.1 (Umezawaea tangerina); KL571860.1 (Umezawaea tangerina); KL571861.1 (Umezawaea tangerina); KL571863.1 (Umezawaea tangerina); KL571864.1 (Umezawaea tangerina); KL571865.1 (Umezawaea tangerina); KL571866.1 (Umezawaea tangerina); KL571867.1 (Umezawaea tangerina); KL571868.1 (Umezawaea tangerina); KL571870.1 (Umezawaea tangerina); KL571871.1 (Umezawaea tangerina); KL571872.1 (Umezawaea tangerina); KL571873.1 (Umezawaea tangerina); JNYU01001905.1 (Umezawaea tangerina); KL571875.1 (Umezawaea tangerina); JNYU01001914.1 (Umezawaea tangerina); KL571876.1 (Umezawaea tangerina); KL571878.1 (Umezawaea tangerina); KL571881.1 (Umezawaea tangerina); KL571883.1 (Umezawaea tangerina); KL571884.1 (Umezawaea tangerina); KL571885.1 (Umezawaea tangerina); KL571886.1 (Umezawaea tangerina); KL571887.1 (Umezawaea tangerina); KL571888.1 (Umezawaea tangerina); KL571889.1 (Umezawaea tangerina); KL571890.1 (Umezawaea tangerina); KL571891.1 (Umezawaea tangerina); KL571892.1 (Umezawaea tangerina); KL571893.1 (Umezawaea tangerina); KL571894.1 (Umezawaea tangerina); KL571895.1 (Umezawaea tangerina); KL571896.1 (Umezawaea tangerina); KL571897.1 (Umezawaea tangerina); KL571898.1 (Umezawaea tangerina); KL571899.1 (Umezawaea tangerina); KL571900.1 (Umezawaea tangerina); KL571901.1 (Umezawaea tangerina); KL571902.1 (Umezawaea tangerina); KL571903.1 (Umezawaea tangerina); KL571904.1 (Umezawaea tangerina); KL571906.1 (Umezawaea tangerina); KL571907.1 (Umezawaea tangerina); KL571908.1 (Umezawaea tangerina); KL571909.1 (Umezawaea tangerina); KL571912.1 (Umezawaea tangerina); KL571913.1 (Umezawaea tangerina); KL571914.1 (Umezawaea tangerina); KL571915.1 (Umezawaea tangerina); KL571917.1 (Umezawaea tangerina); KL571918.1 (Umezawaea tangerina); KL571919.1 (Umezawaea tangerina); KL571921.1 (Umezawaea tangerina); KL571922.1 (Umezawaea tangerina); KL571923.1 (Umezawaea tangerina); KL571924.1 (Umezawaea tangerina); KL571926.1 (Umezawaea tangerina); KL571928.1 (Umezawaea tangerina); KL571929.1 (Umezawaea tangerina); KL571930.1 (Umezawaea tangerina); KL571931.1 (Umezawaea tangerina); KL571932.1 (Umezawaea tangerina); KL571933.1 (Umezawaea tangerina); KL571934.1 (Umezawaea tangerina); KL571935.1 (Umezawaea tangerina); KL571937.1 (Umezawaea tangerina); KL571938.1 (Umezawaea tangerina); KL571939.1 (Umezawaea tangerina); KL571940.1 (Umezawaea tangerina); KL571941.1 (Umezawaea tangerina); KL571942.1 (Umezawaea tangerina); JNYU01002611.1 (Umezawaea tangerina); KL571943.1 (Umezawaea tangerina); KL571944.1 (Umezawaea tangerina); KL571945.1 (Umezawaea tangerina); KL571946.1 (Umezawaea tangerina); KL571947.1 (Umezawaea tangerina); KL571948.1 (Umezawaea tangerina); KL571949.1 (Umezawaea tangerina); KL571950.1 (Umezawaea tangerina); KL571951.1 (Umezawaea tangerina); KL571952.1 (Umezawaea tangerina); KL571953.1 (Umezawaea tangerina); KL571954.1 (Umezawaea tangerina); KL571955.1 (Umezawaea tangerina); JNYU01002732.1 (Umezawaea tangerina); KL571956.1 (Umezawaea tangerina); KL571957.1 (Umezawaea tangerina); KL571959.1 (Umezawaea tangerina); KL571960.1 (Umezawaea tangerina); KL571961.1 (Umezawaea tangerina); KL571962.1 (Umezawaea tangerina); KL571963.1 (Umezawaea tangerina); KL571964.1 (Umezawaea tangerina); KL571965.1 (Umezawaea tangerina); KL571966.1 (Umezawaea tangerina); KL571967.1 (Umezawaea tangerina); KL571968.1 (Umezawaea tangerina); KL571969.1 (Umezawaea tangerina); KL571970.1 (Umezawaea tangerina); KL571971.1 (Umezawaea tangerina); KL571972.1 (Umezawaea tangerina); KL571973.1 (Umezawaea tangerina); KL571975.1 (Umezawaea tangerina); KL571976.1 (Umezawaea tangerina); KL571977.1 (Umezawaea tangerina); KL571978.1 (Umezawaea tangerina); KL571980.1 (Umezawaea tangerina); JNYU01002979.1 (Umezawaea tangerina); KL571981.1 (Umezawaea tangerina); KL571982.1 (Umezawaea tangerina); KL571983.1 (Umezawaea tangerina); JNYU01002990.1 (Umezawaea tangerina); KL571984.1 (Umezawaea tangerina); KL571985.1 (Umezawaea tangerina); KL571986.1 (Umezawaea tangerina); KL571987.1 (Umezawaea tangerina); KL571988.1 (Umezawaea tangerina); KL571989.1 (Umezawaea tangerina); KL571990.1 (Umezawaea tangerina); KL571991.1 (Umezawaea tangerina); KL571992.1 (Umezawaea tangerina); KL571993.1 (Umezawaea tangerina); KL571994.1 (Umezawaea tangerina); KL571995.1 (Umezawaea tangerina); KL571996.1 (Umezawaea tangerina); KL571997.1 (Umezawaea tangerina); KL571998.1 (Umezawaea tangerina); KL572000.1 (Umezawaea tangerina); KL572001.1 (Umezawaea tangerina); KL572002.1 (Umezawaea tangerina); KL572003.1 (Umezawaea tangerina); KL572004.1 (Umezawaea tangerina); KL572005.1 (Umezawaea tangerina); KL572006.1 (Umezawaea tangerina); KL572007.1 (Umezawaea tangerina); KL572008.1 (Umezawaea tangerina); KL572009.1 (Umezawaea tangerina); KL572010.1 (Umezawaea tangerina); KL572011.1 (Umezawaea tangerina); KL572012.1 (Umezawaea tangerina); KL572013.1 (Umezawaea tangerina); JNYU01003188.1 (Umezawaea tangerina); KL572015.1 (Umezawaea tangerina); KL572016.1 (Umezawaea tangerina); KL572017.1 (Umezawaea tangerina); KL572018.1 (Umezawaea tangerina); KL572020.1 (Umezawaea tangerina); KL572021.1 (Umezawaea tangerina); KL572022.1 (Umezawaea tangerina); KL572023.1 (Umezawaea tangerina); KL572024.1 (Umezawaea tangerina); KL572026.1 (Umezawaea tangerina); JNYU01003286.1 (Umezawaea tangerina); KL572027.1 (Umezawaea tangerina); KL572028.1 (Umezawaea tangerina); KL572029.1 (Umezawaea tangerina); KL572030.1 (Umezawaea tangerina); KL572031.1 (Umezawaea tangerina); KL572032.1 (Umezawaea tangerina); KL572033.1 (Umezawaea tangerina); KL572034.1 (Umezawaea tangerina); KL572035.1 (Umezawaea tangerina); JNYU01003362.1 (Umezawaea tangerina); KL572036.1 (Umezawaea tangerina); KL572037.1 (Umezawaea tangerina); KL572038.1 (Umezawaea tangerina); KL572039.1 (Umezawaea tangerina); KL572040.1 (Umezawaea tangerina); KL572041.1 (Umezawaea tangerina); JNYU01003387.1 (Umezawaea tangerina); KL572042.1 (Umezawaea tangerina); KL572043.1 (Umezawaea tangerina); KL572044.1 (Umezawaea tangerina); KL572045.1 (Umezawaea tangerina); KL572046.1 (Umezawaea tangerina); KL572047.1 (Umezawaea tangerina); KL572048.1 (Umezawaea tangerina); KL572049.1 (Umezawaea tangerina); KL572050.1 (Umezawaea tangerina); KL572051.1 (Umezawaea tangerina); KL572052.1 (Umezawaea tangerina); KL572053.1 (Umezawaea tangerina); KL572054.1 (Umezawaea tangerina); KL572055.1 (Umezawaea tangerina); KL572056.1 (Umezawaea tangerina); KL572057.1 (Umezawaea tangerina); KL572058.1 (Umezawaea tangerina); KL572059.1 (Umezawaea tangerina); KL572060.1 (Umezawaea tangerina); KL572061.1 (Umezawaea tangerina); KL572062.1 (Umezawaea tangerina); KL572063.1 (Umezawaea tangerina); KL572064.1 (Umezawaea tangerina); KL572065.1 (Umezawaea tangerina); KL572066.1 (Umezawaea tangerina); KL572067.1 (Umezawaea tangerina); KL572068.1 (Umezawaea tangerina); KL572069.1 (Umezawaea tangerina); KL572070.1 (Umezawaea tangerina); KL572072.1 (Umezawaea tangerina); KL572073.1 (Umezawaea tangerina); KL572075.1 (Umezawaea tangerina); KL572077.1 (Umezawaea tangerina); KL572078.1 (Umezawaea tangerina); KL572079.1 (Umezawaea tangerina); JNYU01003628.1 (Umezawaea tangerina); KL572080.1 (Umezawaea tangerina); KL572081.1 (Umezawaea tangerina); KL572082.1 (Umezawaea tangerina); KL572083.1 (Umezawaea tangerina); KL572085.1 (Umezawaea tangerina); KL572086.1 (Umezawaea tangerina); KL572087.1 (Umezawaea tangerina); KL572088.1 (Umezawaea tangerina); KL572089.1 (Umezawaea tangerina); KL572090.1 (Umezawaea tangerina); KL572091.1 (Umezawaea tangerina); JNYU01003703.1 (Umezawaea tangerina); KL572092.1 (Umezawaea tangerina); KL572093.1 (Umezawaea tangerina); JNYU01003712.1 (Umezawaea tangerina); KL572095.1 (Umezawaea tangerina); KL572096.1 (Umezawaea tangerina); KL572097.1 (Umezawaea tangerina); KL572098.1 (Umezawaea tangerina); JNYU01003741.1 (Umezawaea tangerina); KL572099.1 (Umezawaea tangerina); KL572100.1 (Umezawaea tangerina); KL572101.1 (Umezawaea tangerina); KL572102.1 (Umezawaea tangerina); JNYU01003753.1 (Umezawaea tangerina); KL572103.1 (Umezawaea tangerina); KL572104.1 (Umezawaea tangerina); KL572105.1 (Umezawaea tangerina); KL572106.1 (Umezawaea tangerina); KL572107.1 (Umezawaea tangerina); JNYU01003776.1 (Umezawaea tangerina); KL572108.1 (Umezawaea tangerina); JNYU01003790.1 (Umezawaea tangerina); KL572109.1 (Umezawaea tangerina); KL572110.1 (Umezawaea tangerina); KL572111.1 (Umezawaea tangerina); KL572112.1 (Umezawaea tangerina); JNYU01003802.1 (Umezawaea tangerina); KL572113.1 (Umezawaea tangerina); KL572114.1 (Umezawaea tangerina); JNYU01003814.1 (Umezawaea tangerina); JNYU01003815.1 (Umezawaea tangerina); KL572117.1 (Umezawaea tangerina); KL572118.1 (Umezawaea tangerina); KL572119.1 (Umezawaea tangerina); KL572120.1 (Umezawaea tangerina); JNYU01003833.1 (Umezawaea tangerina); KL572121.1 (Umezawaea tangerina); JNYU01003843.1 (Umezawaea tangerina); KL572122.1 (Umezawaea tangerina); JNYU01003858.1 (Umezawaea tangerina); KL572124.1 (Umezawaea tangerina); KL572125.1 (Umezawaea tangerina); KL572126.1 (Umezawaea tangerina); JNYU01003868.1 (Umezawaea tangerina); KL572127.1 (Umezawaea tangerina); KL572128.1 (Umezawaea tangerina); KL572129.1 (Umezawaea tangerina); KL572130.1 (Umezawaea tangerina); KL572131.1 (Umezawaea tangerina); KL572133.1 (Umezawaea tangerina); KL572135.1 (Umezawaea tangerina); KL572136.1 (Umezawaea tangerina); KL572137.1 (Umezawaea tangerina); KL572138.1 (Umezawaea tangerina); KL572140.1 (Umezawaea tangerina); KL572141.1 (Umezawaea tangerina); KL572142.1 (Umezawaea tangerina); KL572143.1 (Umezawaea tangerina); KL572144.1 (Umezawaea tangerina); KL572145.1 (Umezawaea tangerina); KL572146.1 (Umezawaea tangerina); KL572147.1 (Umezawaea tangerina); KL572148.1 (Umezawaea tangerina); KL572149.1 (Umezawaea tangerina); KL572150.1 (Umezawaea tangerina); KL572151.1 (Umezawaea tangerina); KL572153.1 (Umezawaea tangerina); KL572154.1 (Umezawaea tangerina); KL572155.1 (Umezawaea tangerina); KL572156.1 (Umezawaea tangerina); KL572157.1 (Umezawaea tangerina); KL572158.1 (Umezawaea tangerina); KL572159.1 (Umezawaea tangerina); KL572162.1 (Umezawaea tangerina); KL572163.1 (Umezawaea tangerina); KL572164.1 (Umezawaea tangerina); JNYU01004053.1 (Umezawaea tangerina); KL572167.1 (Umezawaea tangerina); KL572168.1 (Umezawaea tangerina); KL572169.1 (Umezawaea tangerina); KL572170.1 (Umezawaea tangerina); JNYU01004066.1 (Umezawaea tangerina); KL572171.1 (Umezawaea tangerina); JNYU01004071.1 (Umezawaea tangerina); KL572173.1 (Umezawaea tangerina); KL572174.1 (Umezawaea tangerina); KL572175.1 (Umezawaea tangerina); KL572177.1 (Umezawaea tangerina); JNYU01004096.1 (Umezawaea tangerina); KL572179.1 (Umezawaea tangerina); KL572180.1 (Umezawaea tangerina); KL572181.1 (Umezawaea tangerina); KL572182.1 (Umezawaea tangerina); JNYU01004122.1 (Umezawaea tangerina); JNYU01004123.1 (Umezawaea tangerina); JNYU01004124.1 (Umezawaea tangerina); KL572184.1 (Umezawaea tangerina); JNYU01004129.1 (Umezawaea tangerina); KL572185.1 (Umezawaea tangerina); KL572186.1 (Umezawaea tangerina); KL572187.1 (Umezawaea tangerina); KL572188.1 (Umezawaea tangerina); KL572189.1 (Umezawaea tangerina); KL572190.1 (Umezawaea tangerina); KL572191.1 (Umezawaea tangerina); KL572192.1 (Umezawaea tangerina); JNYU01004165.1 (Umezawaea tangerina); KL572193.1 (Umezawaea tangerina); JNYU01004172.1 (Umezawaea tangerina); KL572194.1 (Umezawaea tangerina); KL572195.1 (Umezawaea tangerina); KL572196.1 (Umezawaea tangerina); KL572197.1 (Umezawaea tangerina); KL572198.1 (Umezawaea tangerina); KL572200.1 (Umezawaea tangerina); KL572201.1 (Umezawaea tangerina); KL572202.1 (Umezawaea tangerina); KL572203.1 (Umezawaea tangerina); JNYU01004208.1 (Umezawaea tangerina); JNYU01004209.1 (Umezawaea tangerina); KL572204.1 (Umezawaea tangerina); KL572205.1 (Umezawaea tangerina); KL572206.1 (Umezawaea tangerina); KL572207.1 (Umezawaea tangerina); KL572208.1 (Umezawaea tangerina); KL572210.1 (Umezawaea tangerina); KL572211.1 (Umezawaea tangerina); KL572213.1 (Umezawaea tangerina); KL572214.1 (Umezawaea tangerina); KL572215.1 (Umezawaea tangerina); KL572216.1 (Umezawaea tangerina); KL572217.1 (Umezawaea tangerina); KL572218.1 (Umezawaea tangerina); KL572219.1 (Umezawaea tangerina); KL572220.1 (Umezawaea tangerina); KL572222.1 (Umezawaea tangerina); KL572223.1 (Umezawaea tangerina); KL572225.1 (Umezawaea tangerina)

Compact view

KL571727.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 32,538 - 46,533 nt. (total: 13,996 nt) Show pHMM detection rules used

Region on contig edge.

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg11_37: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg11_41: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002115.3	0.40	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000565.5	0.39	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002311.3	0.38	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002485.2	0.38	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000471.4	0.38	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000480.5	0.37	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002115.3	0.40	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000565.5	0.39	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002311.3	0.38	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0002485.2	0.38	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000471.4	0.38	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000480.5	0.37	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 4 - 102; Score: 77.0; RRE type: Cyanobactin_D_RRE; Location: 3 - 80; Score: 59.8; RRE type: NHLP_CD_RRE; Location: 5 - 99; Score: 59.0

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

KL571730.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 31,628 - 76,745 nt. (total: 45,118 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg14_72: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

ctg14_73: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: aminotransferase methyltransferase

ctg14_65: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg14_66: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg14_75: methyltransferase

smcogs: SMCOG1248: methyltransferase

Lyases: dehydratase

ctg14_70: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

ctg14_49: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

ctg14_59: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.09 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.95 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.49 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

Additional weak hits (2):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 31627 - 76745:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg14_59: Cys - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (14..406): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYHVTMINK
Nearest Stachelhaus code(s):: Pyr DVHHVTEINK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1144..1525): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

KL571733.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 9,604 - 86,938 nt. (total: 77,335 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg17_19: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg17_27: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

ctg17_28: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

ctg17_30: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg17_50: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

ctg17_51: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

ctg17_72: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

ctg17_75: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase methyltransferase

ctg17_47: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

ctg17_62: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase phosphatase

ctg17_29: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

ctg17_71: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: dehydratase hydratase lyase

ctg17_23: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

ctg17_44: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

ctg17_68: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

ctg17_32: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg17_33: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg17_34: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg17_36: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg17_37: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg17_41: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg17_48: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg17_77: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg17_79: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.65	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.70	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002071.2	0.65	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.28 out of 25.88

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 27.04

Confidence: medium

Additional weak hits (12):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.97 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.75 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.43 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.99 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.04 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.63 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.07 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.52 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.39 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.10 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.78 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.91 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 9603 - 86938:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 9603 - 64827:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg17_33: X

AMP-binding (226..605): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGMAGGLVLK
Nearest Stachelhaus code(s):: Orn DSDDGGLVDK (53% 8Å match); R-bmeTrp DAGALGVVLK (50% 8Å match); OH-Orn DAQEGGLVDK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

ctg17_36: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (33..214): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALIVGGVCK
Nearest Stachelhaus code(s):: S-bohPhe or Phe DALIVAAVCK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg17_41: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (9..406): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DLAESGAADK
Nearest Stachelhaus code(s):: ohEnd DLSVMGAVDK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

ctg17_48: X

AMP-binding (26..471): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LQYMDT-LWK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg17_77: X

AMP-binding (5..244): X

nrpys: Ile, Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGGTFK
Nearest Stachelhaus code(s):: Leu or Ile DAFFLGMTFK (74% 8Å match); Ile DAFFLGVTFK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg17_79: X

AMP-binding (461..703): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGPY-----K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
MexT	Global virulence regulator
PsrA	Oleic acid responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

KL571735.1 - Region 1 - arylpolyene

Download region GenBank file

Download region SVG

Location: 67,009 - 108,169 nt. (total: 41,161 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg19_63: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

ctg19_64: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

ctg19_77: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: hydrolase

ctg19_96: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: decarboxylase

ctg19_76: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: synthase

ctg19_72: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg19_74: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg19_75: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg19_80: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002554.2	0.47	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001903.3	0.45	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000922.5	0.45	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001150.5	0.45	PKS	pamamycin-607, pamamycin-621A, pamamycin-635G, pamamycin-663A, homopamamycin-677A, pamamycin-649B	Streptomyces alboniger
BGC0001948.3	0.45	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002381.3	0.45	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002554.2	0.47	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001903.3	0.45	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0000922.5	0.45	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001150.5	0.45	PKS	pamamycin-607, pamamycin-621A, pamamycin-635G, pamamycin-663A, homopamamycin-677A, pamamycin-649B	Streptomyces alboniger
BGC0001948.3	0.45	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002381.3	0.45	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.60 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.72 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.84 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.44 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

KL571743.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 62,499 - 73,314 nt. (total: 10,816 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

ctg27_74: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.33	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002122.2	0.23	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0002788.2	0.21	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001574.5	0.20	NRPS	SF2768	Streptomyces thioluteus
BGC0002338.3	0.20	PKS	Sorangipyranone	Myxococcales bacterium
BGC0001138.5	0.18	other (nucleoside)	a201a	Marinactinospora thermotolerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.33	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002122.2	0.23	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0002788.2	0.21	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001574.5	0.20	NRPS	SF2768	Streptomyces thioluteus
BGC0002338.3	0.20	PKS	Sorangipyranone	Myxococcales bacterium
BGC0001138.5	0.18	other (nucleoside)	a201a	Marinactinospora thermotolerans

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.52 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

KL571747.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 20,110 nt. (total: 20,110 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg32_10: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg32_9: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acylase

ctg32_19: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora
BGC0000979.3	0.43	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora
BGC0000979.3	0.43	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.50 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.95 out of 26.85

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.95 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg32_19: mmal

PKS_AT (279..570): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 79.2%; Propionyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 145.7
Methoxymalonyl-CoA: 125.7
Ethylmalonyl-CoA: 112.6
Isobutyryl-CoA: 95.7
Malonyl-CoA: 91.1
trans-1,2-CPDA: 75.3
Propionyl-CoA: 74.5
Benzoyl-CoA: 73.9
2-Methylbutyryl-CoA: 72.8
Acetyl-CoA: 47.6
CHC-CoA: 40.5
inactive: 40.3
3-Methylbutyryl-CoA: 34.7
fatty_acid: 16.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
RutR	Regulator of the pyrimidine and purine metabolism

KL571761.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 24,861 nt. (total: 24,861 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

ctg46_13: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg46_23: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: methyltransferase

ctg46_12: methyltransferase

smcogs: SMCOG1248: methyltransferase

Isomerases: isomerase

ctg46_19: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

ctg46_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg46_20: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

ctg46_8: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.58	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.58	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.56	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.56	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.56	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002174.2	0.55	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.55	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.61	NRPS	enniatin	Fusarium equiseti

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

KL571766.1 - Region 1 - T3PKS,terpene

Download region GenBank file

Download region SVG

Location: 1 - 39,528 nt. (total: 39,528 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

ctg52_11: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

ctg52_12: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

ctg52_2: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg52_23: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg52_6: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

ctg52_8: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acetyltransferase

ctg52_25: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: cyclase hydratase

ctg52_10: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

ctg52_13: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

ctg52_14: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

ctg52_7: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

ctg52_15: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

ctg52_18: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg52_19: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg52_22: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.50	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002391.2	0.47	terpene	zealexin B3, zealexin C2	Zea mays
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0002173.2	0.39	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000675.5	0.39	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0001969.3	0.37	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002721.2	0.37	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0000282.3	0.36	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002403.2	0.34	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001148.5	0.34	NRPS, ribosomal	pheganomycin	Streptomyces cirratus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.59	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0001924.3	0.53	terpene	ascofuranone	Acremonium egyptiacum
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002173.2	0.52	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0002721.2	0.52	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0000675.5	0.51	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002260.3	0.51	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0001969.3	0.51	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0001843.2	0.50	NRPS	tridecaptin M	Paenibacillus sp. M-152

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg52_5: T2TS

Domain 1 (198 - 499): Type 2 terpene synthase

Subtype: unknown

ctg52_7: T1TS

Domain 1 (23 - 302): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.97 out of 24.78

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

ctg52_19: X

AMP-binding (42..249): X

No predictions made

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

KL571774.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 41,503 - 71,726 nt. (total: 30,224 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg61_48: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg61_54: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg61_55: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

ctg61_57: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg61_70: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase methyltransferase

ctg61_51: aminotransferase

smcogs: SMCOG1019: aminotransferase

ctg61_56: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

ctg61_59: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: protease

ctg61_66: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001529.5	0.50	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002007.2	0.50	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001528.4	0.48	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001206.5	0.46	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001485.4	0.46	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001529.5	0.50	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002007.2	0.50	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001528.4	0.48	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001206.5	0.46	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001485.4	0.46	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg61_53: T2TS

Domain 1 (160 - 387): Type 2 terpene synthase

Subtype: unknown

ctg61_59: PT_FPPS_like

Domain 1 (397 - 688): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.06 out of 26.85

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (5):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 24.05 out of 30.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.65 out of 29.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RutR	Regulator of the pyrimidine and purine metabolism

KL571788.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 37,305 - 58,264 nt. (total: 20,960 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg76_58: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase

ctg76_50: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Lyases: cyclase

ctg76_47: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.48	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0001810.3	0.33	PKS	trehangelin	Polymorphospora rubra
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000188.5	0.32	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000633.3	0.31	terpene	carotenoid	Streptomyces avermitilis
BGC0002246.3	0.31	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0002496.3	0.31	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000916.5	0.30	other (other)	molybdenum cofactor	Staphylococcus carnosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.48	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0001810.3	0.33	PKS	trehangelin	Polymorphospora rubra
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000188.5	0.32	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000633.3	0.31	terpene	carotenoid	Streptomyces avermitilis
BGC0002246.3	0.31	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0002496.3	0.31	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000916.5	0.30	other (other)	molybdenum cofactor	Staphylococcus carnosus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg76_47: T1TS

Domain 1 (22 - 311): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.84 out of 20.97

Confidence: medium

Additional weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 27.04

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

KL571792.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1 - 14,830 nt. (total: 14,830 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg80_19: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.58	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.56	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.56	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.55	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.54	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000584.5	0.47	ribosomal	colicin V	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000553.3	0.44	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.58	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.56	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.56	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.55	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.54	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000584.5	0.47	ribosomal	colicin V	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000553.3	0.44	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.90 out of 29.72

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.84 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.63 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.42 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.99 out of 29.51

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

KL571803.1 - Region 1 - indole

Download region GenBank file

Download region SVG

Location: 18,526 - 39,452 nt. (total: 20,927 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg91_27: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg91_33: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001294.5	0.49	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002643.2	0.46	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000391.5	0.32	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000876.5	0.31	other (other)	neopolyoxin C	Streptomyces tendae
BGC0000665.5	0.30	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001294.5	0.49	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002643.2	0.46	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001910.4	0.37	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000391.5	0.32	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000876.5	0.31	other (other)	neopolyoxin C	Streptomyces tendae
BGC0000665.5	0.30	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.54 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.96 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.10 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.58 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.80 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.81 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.90 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

KL571809.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 29,457 nt. (total: 29,457 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg97_19: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

ctg97_10: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 29457:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg97_10: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (409..810): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

KL571811.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 14,896 nt. (total: 14,896 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg99_13: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

ctg99_2: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg99_9: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

ctg99_8: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

ctg99_12: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.70	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.65	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.52	terpene	carotenoid	Brevibacterium linens
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.70	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.65	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.52	terpene	carotenoid	Brevibacterium linens
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

ctg99_6: Lycopene_cycl

Domain 1 (5 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

ctg99_7: Lycopene_cycl

Domain 1 (5 - 95): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

ctg99_11: PT_phytoene_like

Domain 1 (17 - 305): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

ctg99_12: PT_FPPS_like

Domain 1 (48 - 272): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

KL571817.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 5,037 - 37,159 nt. (total: 32,123 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg105_25: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg105_26: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg105_28: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 5036 - 37159:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg105_25: X

AMP-binding (464..861): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALQMGGGFK
Nearest Stachelhaus code(s):: Val DALWMGGTFK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg105_26: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (453..828): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGVFK
Nearest Stachelhaus code(s):: Val DALWLGGVFK (50% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg105_28: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (42..413): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

KL571829.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 37,274 nt. (total: 37,274 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg117_12: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg117_17: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: Halogenation acylase

ctg117_2: flavin-dependent trp 6 7 halogenase

halogenases: flavin-dependent trp 6 7 halogenase
MITE: MITE0000130Halogenation (identity: 62.90%)

ctg117_21: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deaminase

ctg117_4: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

ctg117_5: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

ctg117_7: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg117_8: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg117_9: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.76	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.76	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.65 out of 27.04

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.44 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.55 out of 31.73

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.75 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.62 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.14 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.18 out of 26.85

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 37274:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Trp) + (Gly) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg117_7: Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (1129..1595): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWAVAGIAK
Nearest Stachelhaus code(s):: Trp DAWAFAGVAK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg117_9: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (122..525): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQIGMIWK
Nearest Stachelhaus code(s):: Gly DILQVGMIWK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg117_21: mal

PKS_AT (60..437): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 54.5
Methoxymalonyl-CoA: 27.2
Methylmalonyl-CoA: 22.0
Ethylmalonyl-CoA: 20.9
trans-1,2-CPDA: 19.6
2-Methylbutyryl-CoA: 16.9
CHC-CoA: 15.9
Propionyl-CoA: 14.7
Acetyl-CoA: 12.7
Isobutyryl-CoA: 9.4
fatty_acid: 9.3
Benzoyl-CoA: 8.7
inactive: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor

KL571837.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 38,742 nt. (total: 38,742 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg125_10: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg125_21: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase aminotransferase glycosyltransferase

ctg125_17: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg125_8: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg125_9: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.65	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.64	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001876.2	0.55	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001051.5	0.54	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001219.3	0.53	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.65	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.64	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001876.2	0.55	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001051.5	0.54	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001219.3	0.53	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 38742:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg125_17: mal

PKS_AT (149..462): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.5
inactive: 74.0
Methoxymalonyl-CoA: 52.2
Methylmalonyl-CoA: 43.0
Ethylmalonyl-CoA: 17.1
Acetyl-CoA: 16.7
Benzoyl-CoA: 15.6
Isobutyryl-CoA: 14.9
Propionyl-CoA: 14.5
CHC-CoA: 11.8
2-Methylbutyryl-CoA: 9.4
fatty_acid: 7.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg125_21: mal

PKS_AT (814..1074): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.0
inactive: 56.4
Methoxymalonyl-CoA: 22.2
Methylmalonyl-CoA: 13.5
Propionyl-CoA: 12.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

KL571855.1 - Region 1 - HR-T2PKS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 36,457 nt. (total: 36,457 nt) Show pHMM detection rules used

Region on contig edge.

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg144_18: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

ctg144_13: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase synthetase

ctg144_12: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg144_15: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg144_27: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.5	0.29	other (other)	bacilysin	Bacillus sp. CS93
BGC0000231.5	0.28	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001276.3	0.26	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000677.5	0.26	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000234.5	0.25	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002309.2	0.25	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001987.2	0.25	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001605.3	0.24	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001184.4	0.24	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001723.5	0.24	PKS	oviedomycin	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000231.5	0.50	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001987.2	0.49	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000234.5	0.48	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002000.4	0.47	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000204.5	0.47	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001723.5	0.46	PKS	oviedomycin	Streptomyces antibioticus
BGC0002047.2	0.46	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002514.3	0.46	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0002547.2	0.45	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces youssoufiensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg144_27: PT_FPPS_like

Domain 1 (4 - 171): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.48 out of 26.85

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.49 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.32 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

KL571859.1 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 2,958 - 31,677 nt. (total: 28,720 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg148_13: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase synthase

ctg148_19: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

ctg148_27: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	0.51	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001441.5	0.46	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002405.2	0.46	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0000904.5	0.43	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0001859.4	0.41	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001295.5	0.41	other (other)	cremeomycin	Streptomyces cremeus
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001221.5	0.38	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001562.5	0.37	NRPS	curacomycin	Streptomyces curacoi
BGC0000067.5	0.37	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	0.51	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001441.5	0.46	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002405.2	0.46	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0000904.5	0.43	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0001859.4	0.41	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0001295.5	0.41	other (other)	cremeomycin	Streptomyces cremeus
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001221.5	0.38	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001562.5	0.37	NRPS	curacomycin	Streptomyces curacoi
BGC0000067.5	0.37	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.74 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.14 out of 21.55

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.00 out of 20.97

Confidence: medium

Additional weak hits (1):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

KL571862.1 - Region 1 - RRE-containing,RiPP-like

Download region GenBank file

Download region SVG

Location: 15,541 - 36,038 nt. (total: 20,498 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg151_37: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Ligases: ligase

ctg151_31: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.46	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.46	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001748.4	0.32	NRPS, PKS	pseudospumigin A, pseudospumigin B, pseudospumigin C, pseudospumigin D, pseudospumigin E, pseudospumigin F	Nostoc sp. CENA543
BGC0002584.2	0.30	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000483.5	0.28	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000565.5	0.27	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002311.3	0.27	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000477.3	0.27	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002518.3	0.27	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0001849.4	0.27	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001748.4	0.49	NRPS, PKS	pseudospumigin A, pseudospumigin B, pseudospumigin C, pseudospumigin D, pseudospumigin E, pseudospumigin F	Nostoc sp. CENA543
BGC0002584.2	0.45	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000565.5	0.44	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001849.4	0.44	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000197.5	0.43	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000483.5	0.43	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0001137.5	0.43	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 24.25 out of 26.33

Confidence: strong

Additional weak hits (1):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 4 - 74; Score: 58.0; RRE type: Cyanobactin_D_RRE; Location: 5 - 70; Score: 57.9; RRE type: NHLP_CD_RRE; Location: 5 - 73; Score: 47.0
: RRE type: Goadsporin_CD_RRE; Location: 4 - 74; Score: 58.0; RRE type: Cyanobactin_D_RRE; Location: 5 - 70; Score: 57.9; RRE type: NHLP_CD_RRE; Location: 5 - 73; Score: 47.0

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator

KL571869.1 - Region 1 - NRPS-like,phosphonate

Download region GenBank file

Download region SVG

Location: 1 - 23,603 nt. (total: 23,603 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg158_8: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase

ctg158_16: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Ligases: ligase

ctg158_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg158_10: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg158_11: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg158_12: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg158_3: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg158_6: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.64	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.84 out of 23.79

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg158_3: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (199..616): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLVWK
Nearest Stachelhaus code(s):: Cys DLYNLSLVWK (65% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg158_10: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (75..418): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg158_12: X

AMP-binding (15..396): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DFLMVGIIFK
Nearest Stachelhaus code(s):: Val DFLQVGIIFK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

KL571874.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 10,984 nt. (total: 10,984 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg163_3: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: carboxylase

ctg163_8: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthetase

ctg163_7: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.39	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001831.3	0.38	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000261.5	0.34	PKS	R1128	Streptomyces sp. R1128
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.33	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000632.5	0.32	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000218.5	0.32	PKS	doxorubicin	Streptomyces peucetius
BGC0001103.5	0.31	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.39	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001831.3	0.38	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000261.5	0.34	PKS	R1128	Streptomyces sp. R1128
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.33	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000632.5	0.32	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000218.5	0.32	PKS	doxorubicin	Streptomyces peucetius
BGC0001103.5	0.31	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg163_7: PT_FPPS_like

Domain 1 (43 - 225): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

KL571877.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 24,818 - 67,499 nt. (total: 42,682 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg168_22: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg168_23: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

ctg168_27: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase glycosyltransferase

ctg168_32: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg168_36: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

ctg168_45: thioesterase

smcogs: SMCOG1004: thioesterase

ctg168_50: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

ctg168_28: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg168_40: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg168_41: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg168_42: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg168_44: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg168_47: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg168_56: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.59 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.46 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 24817 - 67499:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (Hpg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg168_28: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (7..319): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: GGRQVSYGIK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg168_41: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (791..1314): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: DIYHLGLLCK
Nearest Stachelhaus code(s):: Hpg DIYHLGLLCK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg168_42: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (458..749): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg168_47: X

AMP-binding (467..717): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTED-----K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg168_56: X

AMP-binding (2..332): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLFTLGGILK
Nearest Stachelhaus code(s):: Ser DFDTFGGILK (44% 8Å match); Leu DLLHLGLILK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

KL571879.1 - Region 1 - NRPS-like,terpene

Download region GenBank file

Download region SVG

Location: 1 - 32,083 nt. (total: 32,083 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg170_13: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

ctg170_9: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: back translocase glucosidase

ctg170_33: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

ctg170_7: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: ligase

ctg170_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002150.2	0.27	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.27	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002135.2	0.27	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002306.2	0.27	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0001132.4	0.27	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.27	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.27	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.27	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.27	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

ctg170_26: PT_phytoene_like

Domain 1 (8 - 285): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.64 out of 27.55

Confidence: medium

Additional weak hits (1):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

ctg170_1: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (36..235): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
GnfM	Regulator of nitrogen-fixation genes
VqsM	Regulator of quorum-sensing signalling systems

KL571880.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 5,387 - 42,555 nt. (total: 37,169 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg171_13: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

ctg171_14: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

ctg171_16: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg171_21: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg171_27: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Ligases: synthetase

ctg171_25: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

ctg171_29: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000665.5	0.55	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000678.5	0.52	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002309.2	0.45	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000665.5	0.55	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000678.5	0.52	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002309.2	0.45	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg171_12: TS_Pyr4

Domain 1 (36 - 195): Pyr4 type terpene synthase

Subtype: unknown

ctg171_25: PT_FPPS_like

Domain 1 (17 - 270): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

ctg171_29: PT_FPPS_like

Domain 1 (58 - 322): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.53 out of 25.88

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.83 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.02 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
PsrA	Oleic acid responsive regulator

KL571882.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 20,365 - 59,386 nt. (total: 39,022 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg173_33: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg173_34: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg173_44: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg173_50: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase glycosyltransferase

ctg173_45: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg173_46: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: ligase synthase

ctg173_23: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

ctg173_32: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg173_35: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg173_38: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg173_39: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001873.3	0.66	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001873.3	0.66	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 29.05 out of 30.22

Confidence: strong

Additional weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.01 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 20364 - 59386:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg173_32: X

AMP-binding (106..370): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLGMIGI--K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg173_38: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (196..591): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFVSQVAK
Nearest Stachelhaus code(s):: Pro DVQFVSQVMK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg173_39: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (29..414): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator

KL571905.1 - Region 1 - NRP-metallophore,NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 48,944 nt. (total: 48,944 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg196_10: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Hydrolases: hydrolase

ctg196_38: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: ligase

ctg196_15: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg196_16: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg196_19: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg196_20: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.26	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	1.03	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	1.01	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.99	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.97	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.96	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.96	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.95	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.95	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.94	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.57 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (6):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.44 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.67 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.28 out of 27.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.99 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 27.04

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 48944:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (OH-Orn) + (OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 45463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (OH-Orn) + (OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 6244 - 48944:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (OH-Orn) + (OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg196_15: X

AMP-binding (536..975): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPQDFG---K
Nearest Stachelhaus code(s):: Arg DPLDFGVVQK (41% 8Å match); Cap DPQDIGIVNK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

ctg196_16: OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (444..846): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DMENLGLINK
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg196_19: OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (29..426): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVFILGAVNK
Nearest Stachelhaus code(s):: OH-Orn DVFILGAVNK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

KL571910.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 25,579 nt. (total: 25,579 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg201_3: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: hydratase

ctg201_19: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.54	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000889.5	0.49	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.54	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000889.5	0.49	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (2):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.63 out of 26.85

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.44 out of 30.12

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg201_3: mal

PKS_AT (215..569): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.2
inactive: 96.2
Methoxymalonyl-CoA: 61.4
Methylmalonyl-CoA: 56.4
Propionyl-CoA: 34.1
Ethylmalonyl-CoA: 23.3
Isobutyryl-CoA: 17.5
Acetyl-CoA: 15.3
fatty_acid: 11.3
Benzoyl-CoA: 10.6
CHC-CoA: 8.7
trans-1,2-CPDA: 8.1
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

KL571911.1 - Region 1 - azoxy-crosslink

Download region GenBank file

Download region SVG

Location: 11,480 - 30,699 nt. (total: 19,220 nt) Show pHMM detection rules used

Region on contig edge.

azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg202_23: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

ctg202_25: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

ctg202_22: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: ligase

ctg202_33: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.55	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002164.2	0.55	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000551.5	0.46	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.55	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002164.2	0.55	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000551.5	0.46	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

KL571916.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 1 - 22,787 nt. (total: 22,787 nt) Show pHMM detection rules used

Region on contig edge.

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg207_12: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.64	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001250.4	0.57	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.57	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.56	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.55	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.64	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001250.4	0.57	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.57	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.56	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.55	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg207_12: X

AMP-binding (244..488): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAESIGTVVK
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

KL571920.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 24,533 - 35,818 nt. (total: 11,286 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

ctg211_38: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.42	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.42	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000657.5	0.36	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001075.5	0.33	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0000678.5	0.33	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.30	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000666.5	0.28	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001529.5	0.28	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000664.5	0.28	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.42	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.42	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000657.5	0.36	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001075.5	0.33	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0000678.5	0.33	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.30	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000666.5	0.28	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001529.5	0.28	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000664.5	0.28	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg211_38: PT_FPPS_like

Domain 1 (4 - 222): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

KL571925.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 1 - 35,618 nt. (total: 35,618 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg216_10: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg216_21: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg216_5: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase carboxylase glycosyltransferase transferase

ctg216_19: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg216_26: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg216_7: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

ctg216_8: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: dehalogenase protease

ctg216_2: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

ctg216_25: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: synthase

ctg216_23: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.49	PKS	ACT-Toxin II	Alternaria alternata
BGC0002284.3	0.46	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000863.3	0.38	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000861.5	0.38	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0002284.3	0.56	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000863.3	0.51	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000861.5	0.51	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 26.85

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.18 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.20 out of 30.22

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 35618:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk)
Non-colinear ordering:: ctg216_23 + ctg216_24

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg216_19: mal

PKS_AT (189..470): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 67.7
Methoxymalonyl-CoA: 29.2
Methylmalonyl-CoA: 27.4
inactive: 20.0
Propionyl-CoA: 12.8
trans-1,2-CPDA: 11.0
CHC-CoA: 8.4
Ethylmalonyl-CoA: 7.4
2-Methylbutyryl-CoA: 2.9
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg216_23: pk

PKS_AT (482..688): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 12.2
Propionyl-CoA: 6.2
Malonyl-CoA: 4.8
Methylmalonyl-CoA: 3.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

KL571927.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 19,550 nt. (total: 19,550 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg218_4: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Hydrolases: dehalogenase hydrolase

ctg218_11: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

ctg218_6: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001779.5	0.61	ribosomal	siamycin	Streptomyces nodosus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001493.5	0.51	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001539.4	0.51	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001550.3	0.50	ribosomal	citrulassin D	Streptomyces katrae
BGC0001548.4	0.50	ribosomal	citrulassin A	Streptomyces albulus
BGC0002053.3	0.50	ribosomal	ulleungdin	Streptomyces sp.
BGC0001655.3	0.50	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001634.3	0.50	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001779.5	0.61	ribosomal	siamycin	Streptomyces nodosus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001493.5	0.51	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001539.4	0.51	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001550.3	0.50	ribosomal	citrulassin D	Streptomyces katrae
BGC0001548.4	0.50	ribosomal	citrulassin A	Streptomyces albulus
BGC0002053.3	0.50	ribosomal	ulleungdin	Streptomyces sp.
BGC0001655.3	0.50	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001634.3	0.50	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.82 out of 23.79

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (1):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.07 out of 29.38

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

KL571936.1 - Region 1 - NRPS-like,T1PKS,T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 43,472 nt. (total: 43,472 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg227_22: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acylase aminotransferase methyltransferase

ctg227_19: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg227_23: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

ctg227_36: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase synthase

ctg227_10: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg227_35: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

ctg227_4: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg227_5: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000307.4	0.92	NRPS	AbT1	Aureobasidium pullulans
BGC0001284.4	0.86	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.83	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.83	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.80	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.80	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.80	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.80	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000107.3	0.80	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002192.3	0.79	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.65	NRPS	enniatin	Fusarium equiseti
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.23 out of 23.43

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.04 out of 26.85

Confidence: medium

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 43472:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 40062:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 13332 - 43472:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg227_19: X - mal

AMP-binding (20..255): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSQHAGACAK
Nearest Stachelhaus code(s):: Phe DAGALGACAK (35% 8Å match); Leu DALHSGAVAK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

PKS_AT (1101..1394): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 156.9
inactive: 94.4
Methoxymalonyl-CoA: 79.8
Methylmalonyl-CoA: 62.0
Propionyl-CoA: 54.6
Ethylmalonyl-CoA: 44.8
2-Methylbutyryl-CoA: 35.8
trans-1,2-CPDA: 31.2
CHC-CoA: 29.6
Isobutyryl-CoA: 18.4
Benzoyl-CoA: 17.7
Acetyl-CoA: 10.4
3-Methylbutyryl-CoA: 9.8
fatty_acid: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
RutR	Regulator of the pyrimidine and purine metabolism

KL571958.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 25,094 nt. (total: 25,094 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg251_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg251_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Translocases: transporter

ctg251_13: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.59	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.59	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 25094:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg251_1: mmal

PKS_AT (262..545): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 195.8
Ethylmalonyl-CoA: 179.8
2-Methylbutyryl-CoA: 151.1
Methoxymalonyl-CoA: 149.1
Propionyl-CoA: 114.3
trans-1,2-CPDA: 111.3
CHC-CoA: 91.1
Malonyl-CoA: 85.6
Isobutyryl-CoA: 61.8
Benzoyl-CoA: 48.4
Acetyl-CoA: 36.3
inactive: 30.0
fatty_acid: 14.3
3-Methylbutyryl-CoA: 13.3

ctg251_2: mmal

PKS_AT (97..440): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 126.1
Ethylmalonyl-CoA: 120.8
Methoxymalonyl-CoA: 109.3
Propionyl-CoA: 108.1
2-Methylbutyryl-CoA: 107.4
CHC-CoA: 76.3
trans-1,2-CPDA: 69.1
Isobutyryl-CoA: 51.6
Malonyl-CoA: 50.1
Acetyl-CoA: 41.8
Benzoyl-CoA: 34.8
inactive: 21.4
fatty_acid: 19.3
3-Methylbutyryl-CoA: 16.8

Link to PARAS substrate predictor

KL571974.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,043 - 19,579 nt. (total: 15,537 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg267_11: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

ctg267_12: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

ctg267_13: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.46	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000649.3	0.43	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.41	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000650.3	0.39	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000648.3	0.39	terpene	carotenoid	Myxococcus xanthus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.46	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000649.3	0.43	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.41	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000650.3	0.39	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000648.3	0.39	terpene	carotenoid	Myxococcus xanthus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg267_13: PT_FPPS_like

Domain 1 (10 - 118): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (1):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.33 out of 21.55

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

KL571979.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 11,085 - 28,237 nt. (total: 17,153 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

ctg272_27: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000503.5	0.49	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001229.4	0.43	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000517.4	0.41	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000503.5	0.49	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001229.4	0.43	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000517.4	0.41	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg272_27

ctg272_20

Leader:

MPPHLLRVHPKNTGARPPWHGVRWPAASSPSPAARPIPPADQEVKNMKKIAIRKTGSIKLTSSAAG

Core:

YCSPCC

Core with dehydrations:

YCysDhaPCysCys

antiSMASH-DB 4.0 matches for ctg272_20

100.0%

NZ_PVTF01000002.1:

Lanthipeptides: allorf_796702_796920_lanthipeptide

1

YCSPCC

6

YCSPCC

1

YCSPCC

6

allorf_15399_15506

Leader:

MARRPVAAA

Core:

GWGACETTRFRSSCPGRVPPWACPAT

Core with dehydrations:

GWGACysEDhbDhbRFRDhaDhaCysPGRVPPWACysPADhb

antiSMASH-DB 4.0 matches for allorf_15399_15506

30.6%

NZ_JALPRT010000019.1and 1 other:

NZ_KB895919.1 Lanthipeptides: C570_RS1000000130195_lanthipeptide

Lanthipeptides: M0M45_RS13255_lanthipeptide

2

WGACETTRFRSSCPGRVPPWAC

23

WG C T SSC G VP C

17

WGGCST--VCSSCTGSVPIQCC

36

19.5%

NZ_JAABOK010000018.1:

Lanthipeptides: GWG06_RS26535_lanthipeptide

4

ACETTRFRSSC

14

ACE TR SSC

16

ACEDTRQISSC

26

18.2%

NZ_QOIL01000017.1:

Lanthipeptides: allorf_026474_026683_lanthipeptide

7

TTRFRSSCPGRVPPWAC

23

++R C GR PP AC

1

SSRLAPPCQGRRPPSAC

17

with 1 more sequence matches

16.7%

NZ_BMUQ01000012.1:

Lanthipeptides: allorf_026353_026553_lanthipeptide

2

WG-ACETTRFRSSCPGR

17

WG AC+T R R P R

37

WGRACQTPRLRHDPPDR

53

MIBiG 4.0 matches for allorf_15399_15506

19.2%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

5

CETTRFRSSC

14

C TT+ S C

17

CPTTKCTSKC

26

13.5%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

5

CETTRFRSSC

14

C TT+ S C

28

CPTTKCTSRC

37

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.54 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.69 out of 23.79

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

ctg272_20 - Class II

Cleavage pHMM score: -4.30

RODEO score: 0

Monoisotopic mass: 656.2 Da

Molecular weight: 656.8 Da

Number of bridges: 1

allorf_15399_15506 - Class II

Cleavage pHMM score: -5.80

RODEO score: 0

Monoisotopic mass: 2702.3 Da

Molecular weight: 2704.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2722.1 Da N = 1; 2740.1 Da N = 2

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism

KL571999.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 19,138 nt. (total: 19,138 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

ctg294_15: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

ctg294_7: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

ctg294_8: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000504.5	0.43	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002323.2	0.41	ribosomal	nisin J	Staphylococcus capitis
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0002667.2	0.41	ribosomal	estericin A	Clostridium estertheticum
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000518.3	0.40	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000504.5	0.43	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002323.2	0.41	ribosomal	nisin J	Staphylococcus capitis
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0002667.2	0.41	ribosomal	estericin A	Clostridium estertheticum
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000518.3	0.40	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		geosmin	C12	C1-C10	OH
sesquiterpene		germacradienol	C15	C1-C10	OH

Genes with terpene domains:

ctg294_7: T1TS

Domain 1 (1 - 265): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

ctg294_8: T1TS

Domain 1 (1 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.54 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.59 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description

KL572014.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 21,213 nt. (total: 21,213 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

ctg310_9: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: esterase

ctg310_7: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

ctg310_12: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

ctg310_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg310_11: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg310_16: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg310_5: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.91	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.78	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.78	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.77	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.77	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.73	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.76	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.71	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 21213:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg310_1: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (287..577): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNNALTYK
Nearest Stachelhaus code(s):: Ala DLYNNALTYK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg310_5: NH2

CAL_domain (130..440): NH2

minowa: NH2

Prediction, score:

NH2: 94.4
Acetyl-CoA: 43.9
fatty_acid: 31.4
AHBA: 13.7
shikimic_acid: 0.0

ctg310_16: X

AMP-binding (84..515): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGGH-----K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

KL572019.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 14,367 nt. (total: 14,367 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg315_4: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acylase

ctg315_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg315_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg315_8: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.62	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001258.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.62	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001258.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg315_2: mal

PKS_AT (12..300): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.3
inactive: 93.2
Methoxymalonyl-CoA: 65.6
Methylmalonyl-CoA: 45.3
Propionyl-CoA: 36.7
Isobutyryl-CoA: 21.7
Acetyl-CoA: 20.9
CHC-CoA: 16.9
fatty_acid: 15.7
Ethylmalonyl-CoA: 13.9
2-Methylbutyryl-CoA: 10.3
Benzoyl-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg315_5: mmal

PKS_AT (941..1225): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 203.9
Ethylmalonyl-CoA: 201.1
Methoxymalonyl-CoA: 165.9
2-Methylbutyryl-CoA: 133.6
trans-1,2-CPDA: 112.4
Malonyl-CoA: 104.7
CHC-CoA: 100.7
Propionyl-CoA: 99.2
Isobutyryl-CoA: 89.8
Benzoyl-CoA: 71.6
Acetyl-CoA: 62.9
3-Methylbutyryl-CoA: 44.8
fatty_acid: 39.4
inactive: 35.6

Link to PARAS substrate predictor

KL572025.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 12,714 nt. (total: 12,714 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg321_3: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg321_4: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

ctg321_5: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 12714:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg321_5: mal

PKS_AT (444..736): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.9
inactive: 84.1
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 54.7
Propionyl-CoA: 46.6
Isobutyryl-CoA: 26.8
Ethylmalonyl-CoA: 26.3
2-Methylbutyryl-CoA: 22.3
CHC-CoA: 19.2
trans-1,2-CPDA: 18.3
Benzoyl-CoA: 13.4
Acetyl-CoA: 8.6
3-Methylbutyryl-CoA: 8.4
fatty_acid: 0.0

Link to PARAS substrate predictor

KL572071.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 4,293 nt. (total: 4,293 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg370_2: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

ctg370_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001051.5	0.50	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000143.5	0.49	PKS	salinomycin	Streptomyces albus
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001012.3	0.46	NRPS, PKS	meridamycin	Streptomyces violaceusniger

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001051.5	0.50	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000143.5	0.49	PKS	salinomycin	Streptomyces albus
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001012.3	0.46	NRPS, PKS	meridamycin	Streptomyces violaceusniger

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg370_1: mmal

PKS_AT (174..426): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 178.4
Ethylmalonyl-CoA: 160.7
Methoxymalonyl-CoA: 147.4
trans-1,2-CPDA: 101.9
2-Methylbutyryl-CoA: 98.7
Propionyl-CoA: 90.0
Malonyl-CoA: 85.4
CHC-CoA: 76.0
Isobutyryl-CoA: 60.2
Benzoyl-CoA: 56.7
fatty_acid: 33.5
inactive: 32.1
Acetyl-CoA: 31.5
3-Methylbutyryl-CoA: 18.0

Link to PARAS substrate predictor

KL572074.1 - Region 1 - NRPS,NRPS-like,PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 36,196 nt. (total: 36,196 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg373_15: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase

ctg373_24: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase

ctg373_27: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

ctg373_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg373_10: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg373_11: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg373_13: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg373_16: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

ctg373_2: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg373_29: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg373_3: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg373_30: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg373_31: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg373_9: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	1.06	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.05	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	1.05	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.05	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	1.04	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	1.04	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.04	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.02	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	1.02	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	1.01	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.67	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.63 out of 30.22

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 36196:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 35904:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 11795 - 36196:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg373_3: X

AMP-binding (227..614): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DVYSLAMVHK
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg373_9: X

AMP-binding (3..393): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DIWEVTADDK
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg373_11: X

AMP-binding (247..644): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIWELTADDK
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (79% 8Å match); Dab DIWELTADDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg373_13: NH2

CAL_domain (39..451): NH2

minowa: NH2

Prediction, score:

NH2: 110.5
fatty_acid: 24.3
AHBA: 5.3
shikimic_acid: 4.8
Acetyl-CoA: 0.1

ctg373_30: X

AMP-binding (11..249): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIVQ-----K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

KL572076.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 24,342 nt. (total: 24,342 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg375_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg375_7: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.72	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000041.3	0.59	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.57	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001051.5	0.53	NRPS, PKS	thuggacin A	Sorangium cellulosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.72	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000041.3	0.59	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.57	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001051.5	0.53	NRPS, PKS	thuggacin A	Sorangium cellulosum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.81 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 24342:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Me-ccmal) + (ccmal)
Non-colinear ordering:: ctg375_4 + ctg375_2 + ctg375_1 + ctg375_7

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg375_2: mmal

PKS_AT (473..770): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.1
Ethylmalonyl-CoA: 214.9
Methoxymalonyl-CoA: 175.7
2-Methylbutyryl-CoA: 155.8
trans-1,2-CPDA: 133.5
Propionyl-CoA: 109.1
CHC-CoA: 99.0
Malonyl-CoA: 97.8
Isobutyryl-CoA: 96.3
Benzoyl-CoA: 62.5
Acetyl-CoA: 47.2
fatty_acid: 36.0
3-Methylbutyryl-CoA: 29.5
inactive: 23.2

ctg375_4: mal

PKS_AT (0..203): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 136.6
inactive: 72.3
Methoxymalonyl-CoA: 48.1
Methylmalonyl-CoA: 47.7
Acetyl-CoA: 26.4
Ethylmalonyl-CoA: 25.9
Benzoyl-CoA: 24.3
CHC-CoA: 16.5
Isobutyryl-CoA: 16.1
Propionyl-CoA: 14.7
trans-1,2-CPDA: 13.1
2-Methylbutyryl-CoA: 12.8
fatty_acid: 11.3
3-Methylbutyryl-CoA: 0.0

ctg375_7: mal

PKS_AT (437..765): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.8
inactive: 106.9
Methoxymalonyl-CoA: 75.5
Methylmalonyl-CoA: 71.5
Propionyl-CoA: 36.6
Ethylmalonyl-CoA: 35.2
Isobutyryl-CoA: 34.0
CHC-CoA: 21.0
2-Methylbutyryl-CoA: 17.1
Acetyl-CoA: 16.7
Benzoyl-CoA: 13.9
trans-1,2-CPDA: 13.4
fatty_acid: 10.9
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

KL572084.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 1 - 7,062 nt. (total: 7,062 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg384_6: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.45	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0000375.5	0.45	NRPS	indigoidine	Streptomyces chromofuscus
BGC0001778.5	0.35	other (other)	showdomycin	Streptomyces showdoensis
BGC0000219.4	0.31	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0002369.2	0.30	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni
BGC0000934.4	0.29	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0002571.2	0.29	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000195.5	0.28	PKS	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0001985.4	0.28	other (other)	Pyrazofurin	Streptomyces candidus
BGC0002097.3	0.26	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.45	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0000375.5	0.45	NRPS	indigoidine	Streptomyces chromofuscus
BGC0001778.5	0.35	other (other)	showdomycin	Streptomyces showdoensis
BGC0000219.4	0.31	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0002369.2	0.30	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni
BGC0000934.4	0.29	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0002571.2	0.29	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000195.5	0.28	PKS	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0001985.4	0.28	other (other)	Pyrazofurin	Streptomyces candidus
BGC0002097.3	0.26	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

KL572094.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 10,885 nt. (total: 10,885 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg396_5: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: ligase

ctg396_3: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002174.2	0.59	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000041.3	0.55	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002174.2	0.59	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000041.3	0.55	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg396_3: AHBA

CAL_domain (32..374): AHBA

minowa: AHBA

Prediction, score:

AHBA: 173.9
shikimic_acid: 155.4
fatty_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0

ctg396_5: mal

PKS_AT (93..350): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Isobutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 144.1
inactive: 70.7
Methoxymalonyl-CoA: 66.2
Methylmalonyl-CoA: 56.0
Ethylmalonyl-CoA: 24.3
Isobutyryl-CoA: 19.8
Acetyl-CoA: 19.4
2-Methylbutyryl-CoA: 17.1
CHC-CoA: 16.5
Propionyl-CoA: 15.4
Benzoyl-CoA: 15.3
fatty_acid: 14.5
trans-1,2-CPDA: 13.6
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572115.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 3,316 nt. (total: 3,316 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg422_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000067.5	0.43	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002749.2	0.38	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000094.5	0.37	PKS, saccharide	methymycin	Streptomyces venezuelae
BGC0000353.5	0.37	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.36	PKS	oronofacic acid	Pseudomonas syringae
BGC0000122.5	0.36	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000067.5	0.43	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002749.2	0.38	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000094.5	0.37	PKS, saccharide	methymycin	Streptomyces venezuelae
BGC0000353.5	0.37	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.36	PKS	oronofacic acid	Pseudomonas syringae
BGC0000122.5	0.36	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg422_2: emal

PKS_AT (175..298): emal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 100.8
Methylmalonyl-CoA: 98.9
2-Methylbutyryl-CoA: 81.8
Methoxymalonyl-CoA: 80.3
CHC-CoA: 77.4
trans-1,2-CPDA: 66.6
Propionyl-CoA: 61.2
Malonyl-CoA: 49.1
Benzoyl-CoA: 35.4
Isobutyryl-CoA: 27.6
Acetyl-CoA: 25.9
3-Methylbutyryl-CoA: 18.6
fatty_acid: 16.5
inactive: 9.3

Link to PARAS substrate predictor

KL572116.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 6,276 nt. (total: 6,276 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg423_6: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

ctg423_4: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001521.3	0.29	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001060.5	0.29	PKS	dynemicin A	Micromonospora chersina
BGC0000997.4	0.25	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0000148.3	0.24	PKS	A83543A, Spinosyn D	Saccharopolyspora spinosa
BGC0000065.5	0.23	PKS	rustmicin	Streptomyces galbus
BGC0002045.3	0.22	PKS	persiamycin A	Streptomonospora sp. PA3
BGC0000833.4	0.22	other (aminocoumarin), saccharide	coumermycin A1	Streptomyces rishiriensis
BGC0000223.5	0.21	PKS	rabelomycin, dehydrorabelomycin, fluostatin F, fluostatin G, fluostatin H	uncultured bacterium BAC AB649/1850

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001521.3	0.29	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001060.5	0.29	PKS	dynemicin A	Micromonospora chersina
BGC0000997.4	0.25	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0000148.3	0.24	PKS	A83543A, Spinosyn D	Saccharopolyspora spinosa
BGC0000065.5	0.23	PKS	rustmicin	Streptomyces galbus
BGC0002045.3	0.22	PKS	persiamycin A	Streptomonospora sp. PA3
BGC0000833.4	0.22	other (aminocoumarin), saccharide	coumermycin A1	Streptomyces rishiriensis
BGC0000223.5	0.21	PKS	rabelomycin, dehydrorabelomycin, fluostatin F, fluostatin G, fluostatin H	uncultured bacterium BAC AB649/1850

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg423_4: T1TS

Domain 1 (3 - 263): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

KL572123.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 15,118 nt. (total: 15,118 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg434_5: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg434_8: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

ctg434_4: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg434_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.87 out of 26.85

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg434_4: mal

PKS_AT (9..250): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.9
inactive: 113.9
Methoxymalonyl-CoA: 64.0
Methylmalonyl-CoA: 54.4
Propionyl-CoA: 35.2
Acetyl-CoA: 24.0
Benzoyl-CoA: 22.2
Ethylmalonyl-CoA: 19.7
Isobutyryl-CoA: 18.9
trans-1,2-CPDA: 16.6
2-Methylbutyryl-CoA: 13.3
CHC-CoA: 10.6
fatty_acid: 9.5
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

KL572132.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 7,980 nt. (total: 7,980 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg445_1: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000143.5	0.50	PKS	salinomycin	Streptomyces albus
BGC0001065.5	0.50	PKS	herboxidiene	Streptomyces chromofuscus
BGC0000067.5	0.50	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000143.5	0.50	PKS	salinomycin	Streptomyces albus
BGC0001065.5	0.50	PKS	herboxidiene	Streptomyces chromofuscus
BGC0000067.5	0.50	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7980:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg445_1: mal

PKS_AT (0..235): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 103.5
inactive: 53.3
Methoxymalonyl-CoA: 48.1
Methylmalonyl-CoA: 27.0
Propionyl-CoA: 19.4
Acetyl-CoA: 9.1
Ethylmalonyl-CoA: 7.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572134.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 6,836 nt. (total: 6,836 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg447_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg447_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

KL572139.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 7,430 nt. (total: 7,430 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

ctg452_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg452_2: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg452_4: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg452_2: X

A-OX (252..643): X

No predictions made

Link to PARAS substrate predictor

KL572152.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 3,733 nt. (total: 3,733 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg465_3: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.64	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.64	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg465_3: mal

PKS_AT (157..433): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.4
inactive: 97.0
Methoxymalonyl-CoA: 72.2
Methylmalonyl-CoA: 49.5
Propionyl-CoA: 34.7
Isobutyryl-CoA: 25.8
Ethylmalonyl-CoA: 22.4
CHC-CoA: 19.6
Acetyl-CoA: 16.6
Benzoyl-CoA: 16.1
fatty_acid: 15.7
2-Methylbutyryl-CoA: 10.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572160.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 7,634 nt. (total: 7,634 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg473_4: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg473_5: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.50	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000024.5	0.45	PKS	aureothin	Streptomyces thioluteus
BGC0002032.4	0.45	PKS	pentamycin	Streptomyces sp. S816
BGC0000157.5	0.45	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001298.4	0.44	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.50	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000024.5	0.45	PKS	aureothin	Streptomyces thioluteus
BGC0002032.4	0.45	PKS	pentamycin	Streptomyces sp. S816
BGC0000157.5	0.45	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0001298.4	0.44	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg473_4: mal

PKS_AT (169..445): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 223.5
inactive: 116.3
Methoxymalonyl-CoA: 69.0
Methylmalonyl-CoA: 68.9
Propionyl-CoA: 50.5
Isobutyryl-CoA: 27.8
2-Methylbutyryl-CoA: 25.5
Ethylmalonyl-CoA: 23.2
Acetyl-CoA: 22.7
Benzoyl-CoA: 21.1
CHC-CoA: 18.9
trans-1,2-CPDA: 16.7
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572161.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 5,102 nt. (total: 5,102 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg474_2: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000122.5	0.38	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000353.5	0.37	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.37	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.33	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001051.5	0.31	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001647.3	0.31	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0000103.5	0.30	PKS	mycolactone B	Mycobacterium ulcerans Agy99
BGC0000999.4	0.30	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0002365.2	0.29	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001002.5	0.29	NRPS, PKS	jawsamycin	Streptomyces roseoverticillatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000122.5	0.38	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000353.5	0.37	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.37	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.33	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001051.5	0.31	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001647.3	0.31	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0000103.5	0.30	PKS	mycolactone B	Mycobacterium ulcerans Agy99
BGC0000999.4	0.30	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes
BGC0002365.2	0.29	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001002.5	0.29	NRPS, PKS	jawsamycin	Streptomyces roseoverticillatus

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg474_2: mal

PKS_AT (0..150): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 98.5
inactive: 58.9
Methoxymalonyl-CoA: 34.8
Methylmalonyl-CoA: 22.9
Propionyl-CoA: 18.1
2-Methylbutyryl-CoA: 11.3
Ethylmalonyl-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572165.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 22,994 nt. (total: 22,994 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg478_10: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

ctg478_11: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg478_3: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.59	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000041.3	0.57	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000067.5	0.47	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001051.5	0.46	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000147.5	0.44	PKS	soraphen A	Sorangium cellulosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.59	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000041.3	0.57	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000067.5	0.47	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001051.5	0.46	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000147.5	0.44	PKS	soraphen A	Sorangium cellulosum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 22994:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg478_3: mal

PKS_AT (0..190): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 116.5
inactive: 56.6
Methoxymalonyl-CoA: 39.9
Methylmalonyl-CoA: 29.8
Propionyl-CoA: 8.4
Acetyl-CoA: 6.9
Ethylmalonyl-CoA: 3.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg478_9: mmal

PKS_AT (0..169): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 77.5
Ethylmalonyl-CoA: 59.8
Methoxymalonyl-CoA: 52.5
2-Methylbutyryl-CoA: 42.0
trans-1,2-CPDA: 35.3
Isobutyryl-CoA: 35.0
Propionyl-CoA: 28.5
CHC-CoA: 22.8
Malonyl-CoA: 22.4
3-Methylbutyryl-CoA: 19.4
Acetyl-CoA: 16.0
Benzoyl-CoA: 15.0
fatty_acid: 13.3
inactive: 0.0

ctg478_11: mal

PKS_AT (735..1121): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 33.4
inactive: 2.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

KL572166.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 4,242 nt. (total: 4,242 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg479_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002240.3	0.42	PKS	BAB, BAA	Metarhizium anisopliae
BGC0000393.5	0.42	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.38	NRPS, PKS	aspcandine	Aspergillus candidus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002240.3	0.42	PKS	BAB, BAA	Metarhizium anisopliae
BGC0000393.5	0.42	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.38	NRPS, PKS	aspcandine	Aspergillus candidus

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg479_2: mal

PKS_AT (173..452): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.3
inactive: 83.3
Methoxymalonyl-CoA: 69.1
Methylmalonyl-CoA: 63.3
Propionyl-CoA: 34.4
Acetyl-CoA: 26.4
Ethylmalonyl-CoA: 24.9
Isobutyryl-CoA: 23.4
Benzoyl-CoA: 21.0
2-Methylbutyryl-CoA: 17.4
CHC-CoA: 14.7
trans-1,2-CPDA: 11.1
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572172.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 5,337 nt. (total: 5,337 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg488_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001051.5	0.49	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000143.5	0.46	PKS	salinomycin	Streptomyces albus
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001051.5	0.49	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000143.5	0.46	PKS	salinomycin	Streptomyces albus
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.60 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg488_2: mmal

PKS_AT (369..658): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.3
Ethylmalonyl-CoA: 207.3
Methoxymalonyl-CoA: 177.4
2-Methylbutyryl-CoA: 149.5
trans-1,2-CPDA: 121.4
Propionyl-CoA: 113.9
CHC-CoA: 107.1
Malonyl-CoA: 104.3
Isobutyryl-CoA: 70.9
Benzoyl-CoA: 58.7
Acetyl-CoA: 53.2
fatty_acid: 42.9
inactive: 32.3
3-Methylbutyryl-CoA: 28.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

KL572176.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 3,458 nt. (total: 3,458 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg492_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg492_1: mal

PKS_AT (452..742): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.6
inactive: 96.9
Methoxymalonyl-CoA: 55.6
Methylmalonyl-CoA: 48.6
Propionyl-CoA: 36.0
CHC-CoA: 21.6
2-Methylbutyryl-CoA: 18.3
Acetyl-CoA: 15.6
Benzoyl-CoA: 14.7
Isobutyryl-CoA: 13.4
fatty_acid: 9.3
Ethylmalonyl-CoA: 8.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572178.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 3,406 nt. (total: 3,406 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000143.5	0.50	PKS	salinomycin	Streptomyces albus
BGC0000094.5	0.47	PKS, saccharide	methymycin	Streptomyces venezuelae
BGC0001298.4	0.46	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0001051.5	0.46	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000122.5	0.45	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000147.5	0.45	PKS	soraphen A	Sorangium cellulosum
BGC0000979.3	0.45	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9
BGC0000980.3	0.45	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 22D11

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000143.5	0.50	PKS	salinomycin	Streptomyces albus
BGC0000094.5	0.47	PKS, saccharide	methymycin	Streptomyces venezuelae
BGC0001298.4	0.46	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus
BGC0001051.5	0.46	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000122.5	0.45	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000147.5	0.45	PKS	soraphen A	Sorangium cellulosum
BGC0000979.3	0.45	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9
BGC0000980.3	0.45	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 22D11

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 3406:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg495_2: mal

PKS_AT (1..155): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 102.3
inactive: 52.4
Methoxymalonyl-CoA: 35.0
Methylmalonyl-CoA: 24.2
Propionyl-CoA: 16.9
Ethylmalonyl-CoA: 15.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572183.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 6,599 nt. (total: 6,599 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg500_4: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000143.5	0.47	PKS	salinomycin	Streptomyces albus
BGC0001051.5	0.45	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001065.5	0.45	PKS	herboxidiene	Streptomyces chromofuscus
BGC0001876.2	0.44	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001012.3	0.44	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001298.4	0.43	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000143.5	0.47	PKS	salinomycin	Streptomyces albus
BGC0001051.5	0.45	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001065.5	0.45	PKS	herboxidiene	Streptomyces chromofuscus
BGC0001876.2	0.44	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001012.3	0.44	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001298.4	0.43	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

JNYU01004171.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 1,325 nt. (total: 1,325 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg516_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002171.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002171.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

KL572199.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 8,424 nt. (total: 8,424 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg523_3: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg523_5: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg523_4: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.58	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002175.3	0.58	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.58	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.57	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.58	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002175.3	0.58	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.58	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.57	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg523_3: mal

PKS_AT (169..605): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 96.1
inactive: 75.8
Methoxymalonyl-CoA: 54.6
Methylmalonyl-CoA: 47.5
Propionyl-CoA: 25.0
CHC-CoA: 19.1
Acetyl-CoA: 18.0
Isobutyryl-CoA: 16.3
Benzoyl-CoA: 15.8
2-Methylbutyryl-CoA: 13.0
fatty_acid: 11.2
Ethylmalonyl-CoA: 10.3
trans-1,2-CPDA: 8.4
3-Methylbutyryl-CoA: 0.0

ctg523_5: mal

PKS_AT (181..506): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.0
inactive: 96.2
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 62.9
Propionyl-CoA: 45.7
2-Methylbutyryl-CoA: 32.3
Isobutyryl-CoA: 31.7
Ethylmalonyl-CoA: 29.8
CHC-CoA: 27.4
Acetyl-CoA: 24.3
trans-1,2-CPDA: 23.1
Benzoyl-CoA: 21.7
fatty_acid: 12.6
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572209.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 1,386 nt. (total: 1,386 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg535_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.55	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002171.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.55	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002171.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg535_1: mal

PKS_AT (214..461): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.1
inactive: 48.0
Methoxymalonyl-CoA: 32.7
Methylmalonyl-CoA: 28.1
Ethylmalonyl-CoA: 14.5
Propionyl-CoA: 14.0
Acetyl-CoA: 14.0
Benzoyl-CoA: 9.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

KL572212.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 2,751 nt. (total: 2,751 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg538_3: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002171.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.39	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0000041.3	0.35	PKS	oronofacic acid	Pseudomonas syringae
BGC0002749.2	0.35	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000979.3	0.34	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9
BGC0000980.3	0.34	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 22D11
BGC0000353.5	0.34	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000122.5	0.33	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000043.5	0.33	PKS	curacin A	Moorea producens 19L

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002171.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.39	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0000041.3	0.35	PKS	oronofacic acid	Pseudomonas syringae
BGC0002749.2	0.35	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000979.3	0.34	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9
BGC0000980.3	0.34	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 22D11
BGC0000353.5	0.34	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000122.5	0.33	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000043.5	0.33	PKS	curacin A	Moorea producens 19L

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg538_3: mmal

PKS_AT (157..452): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 42.4
Ethylmalonyl-CoA: 40.4
2-Methylbutyryl-CoA: 33.0
trans-1,2-CPDA: 30.5
Methoxymalonyl-CoA: 30.4
CHC-CoA: 29.4
Propionyl-CoA: 26.7
3-Methylbutyryl-CoA: 25.4
Malonyl-CoA: 21.3
Isobutyryl-CoA: 14.5
fatty_acid: 13.5
Benzoyl-CoA: 13.4
Acetyl-CoA: 7.6
inactive: 0.0

Link to PARAS substrate predictor